(data stored in ACNUC7421 zone)

EMBL: CP000283.PE55

CP000283.PE55        Location/Qualifiers
FT   CDS_pept        complement(67486..67848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37295"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F44"
FT                   /protein_id="ABE37295.1"
FT                   /translation="MRLAPSWIIRQSQLLASTERAAEQSVAPTFAECGHSPLEGWTPHS
FT                   ARQKMQLPVSSHPHRDIVLSAAAPGHIVDACEKSRPNQPRSRIDVVDICLQTTPSPASA
FT                   VSPHRSREPRKSLTSN"
     gtgaggttgg cgccctcgtg gattattcgg caatctcaat tgcttgcatc gacggagcgc        60
     gccgctgaac aatcagtcgc accgactttc gcggaatgcg gccattcgcc gctcgaaggt       120
     tggacgcctc acagcgcgcg ccaaaaaatg cagttaccag tttcatcgca cccgcaccgc       180
     gacatcgtcc tgtcggccgc tgcgccggga cacatcgtcg acgcgtgcga gaagtcgcgg       240
     ccgaaccagc cgagatcacg gatcgacgtg gtcgacatct gtctccagac gacgccatcg       300
     cctgcatcgg ctgtttctcc ccatcgatct cgagagcccc gcaagtcgtt gacatcaaac       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page