(data stored in ACNUC7421 zone)

EMBL: CP000283.PE551

CP000283.PE551       Location/Qualifiers
FT   CDS_pept        complement(624737..625726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0553"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37791"
FT                   /db_xref="GOA:Q13DP8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DP8"
FT                   /protein_id="ABE37791.1"
FT                   /translation="MRPDSFMAKAQPAPAPIELACASADLNAEFTRWLSHLRAERRLSG
FT                   KTLEAYARDLRQFLIFLAGHWGGVVTLGRFARLEATDVRAFMAARRGDAIAGRSLMRAL
FT                   AGLRSFGRFLEREGKGSVGALSSVRAPKIKKSLPKPIQIAAAKRLADADERAGEDRETW
FT                   ILVRDAAVMALLYGSGLRISEALGLRRRDVPAPGKGDTLIVLGKGNKTRMVPVLQNVLA
FT                   QIADYASACPHPLPPDGPMFVGARGGPLSPRIIQLAMERLRGSLGLPDSATPHALRHSF
FT                   ATHLLTRGGDLRAIQELLGHASLSTTQVYTGIDTERLLEVYNSAHPRA"
     atgcgcccgg actcctttat ggccaaagcc caacccgccc ccgcgccgat cgagctcgcc        60
     tgcgccagcg ccgatctcaa cgccgagttc acccgctggc tgtcgcatct gcgcgccgag       120
     cgacggctct ccggcaagac gctggaggcc tatgcgcggg atttgcgcca gttcctgatc       180
     ttcctcgccg gccattgggg tggcgtggtc acgctcggtc gattcgcacg gctggaggcc       240
     accgatgtcc gcgccttcat ggcggcgcgg cgcggcgatg cgatcgccgg ccgttcgctg       300
     atgcgggcgc tggccggact gcgctcgttc ggccgcttcc ttgaacgcga aggcaagggc       360
     agcgtcggcg cgctgtcgtc ggtgcgggcg cccaagataa agaaaagcct gcccaaaccg       420
     atccagatcg ccgccgccaa acggctcgcc gacgccgacg agcgcgccgg cgaggaccgc       480
     gagacctgga tcctcgtccg cgacgccgcg gtgatggcgc tgttatacgg ctcaggcctg       540
     cgcatttccg aagcgcttgg gctgcgccgc cgcgatgtgc cggcgccggg caaaggcgac       600
     acgctgatcg tgctcggcaa gggcaacaag acccggatgg tgccggtgct gcaaaacgtg       660
     ctggcgcaga tcgccgatta cgcgagcgcc tgcccgcatc cgctgccgcc ggacgggccg       720
     atgttcgtcg gcgcccgagg cggaccgctc agcccgcgaa tcatccagct cgcgatggag       780
     cggctgcgcg gctcgctggg attgcccgac tcggccacgc cccatgcgct gcggcactcc       840
     ttcgcgacgc atcttttgac ccgcggcggc gatctgcggg cgatccagga gctgctcggc       900
     cacgcctcgc tgtcgaccac gcaggtttac accggcatcg ataccgaacg gctgctggaa       960
     gtctacaaca gcgcccaccc gcgggcatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page