(data stored in ACNUC7421 zone)

EMBL: CP000283.PE555

CP000283.PE555       Location/Qualifiers
FT   CDS_pept        629944..631476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0557"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37795"
FT                   /db_xref="GOA:Q13DP4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP4"
FT                   /protein_id="ABE37795.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVLAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRSIVDTPVGKGLL
FT                   GRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAVGQKRSTVAQFVKVLE
FT                   EQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDHGSGSLTALPIIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDALP
FT                   VAKVRSFEDGLLSLLRGKESAILDAIRTSRDLSDDTAAKLKAVIESYAKTFA"
     atggacatcc gcgccgcgga aatttccgcg atcctcaagg accagatcaa gaacttcggt        60
     caggaagccg aagtcaccga ggtcggacag gtgctgtccg tcggcgacgg cattgcccgc       120
     gtctacggtc tggacaatgt cctcgccggt gaaatggtcg agttcgagaa cggcacgcgc       180
     ggaatggcgc tgaacctcga aaccgacaac gtcggcatcg tgatcttcgg cgccgaccga       240
     gagatcaagg aaggtcagac cgtcaagcgc acccgctcga tcgtcgacac gccggtcggc       300
     aaggggctgc tgggccgcgt cgtcgacgcg ctcggcaacc cgatcgacgg caaggggccg       360
     atccaggcga ccgaacgcaa gcgcgtcgac gtcaaggcgc ccggcatcat tccgcgcaag       420
     tcggtgaacg agccgatggc gaccggcctc aaggcgatcg acgccctgat cccggtcggc       480
     cgcggccagc gcgagctgat cattggcgac cgtcagaccg gcaagaccgc gatcgcgctc       540
     gacaccatcc tgaaccagaa gccgctcaac gtcgaaggcg cgccggaagg ccagaagctt       600
     tactgcgtct atgtcgcggt cggccagaag cgttcgaccg tcgcgcagtt cgtgaaggtg       660
     ctggaagagc agggcgcgct cgaatattcg atcgtcgtcg ccgccaccgc ctccgacccg       720
     gcgccgatgc agtacatcgc gccgttcacc ggctgcacca tgggcgagta cttccgcgac       780
     aacggcatgc acgccgtgat catctatgac gatctgtcga agcaggccgt cgcctaccgc       840
     cagatgtcgc tgctgctgcg ccgcccgccg ggtcgcgagg cctatccggg cgacgtgttc       900
     tatctgcact cccgcctgct tgagcgcgcc gccaagctca acgaagatca cggctcgggg       960
     tctttgaccg cgctgccgat catcgaaacc caggccaacg acgtttccgc ctacatcccg      1020
     accaacgtga tttcgatcac cgacggccag atcttcctgg aaaccgacct gttcttccag      1080
     ggcatccgcc cggcggtgaa cgtcggcctg tcggtgtcgc gcgtcggttc gtcggcacag      1140
     accaaggcga tgaagaaggt cgccggcaag atcaagggcg agctcgcgca gtaccgcgaa      1200
     atggccgcgt tcgcgcagtt cggctctgac ctcgacgcct cgacccagcg cctgctgaac      1260
     cgtggctccc gcctgaccga actcctgaag cagccgcagt tctcgccgct gaagatggaa      1320
     gagcaggtcg tggtgatcta cgccggcgtc aacggttatc tggacgcgct tccggtcgcc      1380
     aaggtgcgct cgttcgagga cggcctgctg tcgctgctgc gcggcaagga atcggccatc      1440
     ctcgatgcga tccgcaccag ccgcgacctc tccgacgaca ccgcagccaa gctcaaggct      1500
     gtgatcgaga gctacgccaa gacgttcgcg taa                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page