(data stored in ACNUC7421 zone)

EMBL: CP000283.PE561

CP000283.PE561       Location/Qualifiers
FT   CDS_pept        636526..637596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37801"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN8"
FT                   /protein_id="ABE37801.1"
FT                   /translation="MTAPVDISNARILEIGGGYFKLQYPERTTCLWTWTKLTNDFGPLD
FT                   GFSTPDRIWRELRAAAEGKYDVVVVNTLRYSPWHPRYWARGMFYTPKSPWASLTRQFGP
FT                   SVLRWLNVPVPLIAVEMDDSFGISKSSVFLLDKAKAYFKRELPADKWQVLAGTIHPHLP
FT                   TLRYRRSEKWRRRIDRLQPISLPQFRFDQRWRDAPFPEKTHDIFFSGAVEGNSTVRAAG
FT                   LPELERLRAMGVRIDQPTERLPYDAFMERMSHSWLAWSPEGMGWDCYRHYEAPLVQAVP
FT                   LMNNPTILRYAPLLSGVHGVYYDIEPGGLVRAVTAALADKDKLRAIAVAGREHVLAHHT
FT                   VKAHCDHILQAALAGR"
     atgaccgcgc ccgtcgacat ctccaacgcc cggatcctcg aaatcggcgg cggctatttc        60
     aagctgcagt atcccgaacg caccacctgc ctgtggacct ggaccaagct caccaatgat       120
     ttcggcccgc tcgacggctt ctcgacgccc gaccggatct ggcgcgaact gcgcgccgcg       180
     gccgaaggca aatacgacgt ggtggtggtc aacacgctgc gctattcgcc gtggcatccg       240
     cgctactggg cgcgcggcat gttctacacg ccaaagagcc cgtgggcatc gttgacgcgg       300
     cagttcgggc ccagcgtgtt gcgctggctg aacgttccgg tgccgctgat cgcggtcgag       360
     atggacgatt cattcggcat ctcgaaaagt agcgtgttcc tgctcgacaa ggccaaggcg       420
     tatttcaagc gcgagctgcc ggccgataaa tggcaggtgc tggccggcac catccatccg       480
     catctgccga cgctgcgcta tcgccggagc gaaaaatggc gccgccggat cgaccggctg       540
     cagccgatct cgctgccgca gttccggttc gaccagcgct ggcgcgacgc gccgtttccg       600
     gagaagaccc acgacatctt cttctcgggc gcggtcgagg gcaattcgac ggtgcgcgcc       660
     gccggcctgc ccgagctcga acggcttcgg gcgatgggcg tgcggatcga ccagccgacc       720
     gagcggctgc cctacgatgc cttcatggag cggatgtcgc attcctggct ggcctggtcg       780
     ccggaaggca tgggctggga ctgctaccgc cactacgagg cgccgctcgt gcaggcggtg       840
     ccgctgatga acaacccgac catcctgcgc tacgcgccgc tgctgtcagg cgtccatggc       900
     gtgtattacg acatcgagcc gggcggactc gtgcgcgccg tcaccgcggc gctcgccgac       960
     aaggacaagc tccgcgcgat cgccgtggcc gggcgggagc atgtgctcgc gcatcacacc      1020
     gtcaaggcgc attgcgacca catcctgcag gcggcgctgg cgggccgata g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page