(data stored in ACNUC7421 zone)

EMBL: CP000283.PE563

CP000283.PE563       Location/Qualifiers
FT   CDS_pept        complement(638389..639624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0565"
FT                   /product="protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37803"
FT                   /db_xref="GOA:Q13DN6"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DN6"
FT                   /protein_id="ABE37803.1"
FT                   /translation="MSVSADELSTPLGQKRGRLRRFRLPFTITQAIATLLGVFLLGFLG
FT                   FALFNNDPLGGEPTVQVMIKPPAPDEKKEAAAPADKSSAAKAAKSEFAEAKDGKDAVQP
FT                   GQKTITIIDGSKGTRQDVVVSSGSGDDKVDAPPAEPAMANGINPKLLEQSRYGMIPVAA
FT                   GALKPVSAYAMTTDADRAKAEKMPTIAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYG
FT                   SDPGKLVEQARAKQHEVLLQIPMEPFDYPDNDPGPQTLLTSGAPEQNLDRLTWHLSRIQ
FT                   GYVGLSNFMGARFVATDAAMQPIIREAAKRGLGYLDDGSAPRSVAPSLAKSLAMPFARA
FT                   DSAIDAVPTAAEIDKALARLEALAKERGSAVGTASALPVSIERIVSWSKSLESRGILLV
FT                   PLTMAMLKSKST"
     ttgtctgtgt cggcggacga actgagcaca ccgctgggtc agaagcgcgg gcgactgcgc        60
     cgcttccgct tgccgttcac catcacccag gcgatcgcga cgctgctcgg cgtcttcctg       120
     ctcggcttcc tcggcttcgc gctgttcaac aacgatccgc tcggcggcga gccgaccgtc       180
     caagtgatga tcaaaccgcc tgcccccgac gaaaagaagg aagccgccgc gcccgcagac       240
     aagtcctccg ccgccaaggc ggcgaagtcc gagttcgccg aggcgaagga cggcaaggac       300
     gcggttcagc cggggcagaa gaccatcacc atcatcgacg gctccaaggg cacccgtcag       360
     gacgtggtgg tgtcgagcgg cagcggcgac gacaaggtcg acgcgccgcc ggccgagccg       420
     gcgatggcca atggcatcaa tccgaagctg ctggagcagt cgcgctacgg catgatcccg       480
     gtcgcggccg gcgcgctgaa gccggtgtcg gcctatgcga tgaccaccga cgccgaccgt       540
     gccaaggccg agaagatgcc gaccattgcg atcgtcgtca ccggcctcgg cgtcggcgcg       600
     gcgcggacca atgatgcggt gatcaagctg ccgcgcgcgg tgaccctggc gttcacgccc       660
     tatgggtccg accccggcaa gctggtcgag caggcgcggg cgaagcagca cgaagtgctg       720
     ctgcagattc cgatggagcc gtttgactat ccggacaacg atcccggtcc gcagaccctg       780
     ctcacctccg gcgcgccgga gcagaacctc gaccgcctga cctggcacct cagccggatc       840
     cagggctatg tcggtctgtc gaacttcatg ggcgcacgct tcgtcgcgac cgatgcggcg       900
     atgcagccga tcatccgcga ggccgccaag cgtgggctcg gctatctcga cgacggctcg       960
     gccccgcgca gcgtcgcgcc gagcctggcg aaatcgctgg cgatgccgtt cgcgcgcgcg      1020
     gattccgcga tcgacgccgt gccgaccgcg gccgaaatcg acaaggcgct ggcccggctc      1080
     gaggcgctcg ccaaggagcg cgggagcgcg gtcggcacgg cctcggcgct accggtgtcg      1140
     attgaacgaa ttgttagctg gagcaagagc ttggagagcc gcggcatcct gctggtgcca      1200
     ttgacaatgg cgatgctgaa atcaaaatca acctag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page