(data stored in ACNUC7421 zone)

EMBL: CP000283.PE57

CP000283.PE57        Location/Qualifiers
FT   CDS_pept        69012..69314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37297"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F42"
FT                   /protein_id="ABE37297.1"
FT                   /translation="MMPLLLCPNDNGSMQTVQRSGVEFDICPTCRGVWLDRGELEKLLA
FT                   VSRSDDSGDAQAHAQPVRDAFNARPAPRSEGRREWDDDDDYGRKRRRSSIFDIFD"
     atgatgccgc ttttgttgtg cccgaacgac aatggatcga tgcagaccgt gcagcggtcc        60
     ggagtcgagt tcgacatctg cccgacctgc cgcggcgtct ggctggatcg cggcgaactc       120
     gaaaaacttc tggcggtgtc gcgcagcgac gattcaggcg acgcgcaagc ccacgctcag       180
     cccgtgcgcg acgcgttcaa cgcgcgaccg gcgccgcgat ccgaaggtcg gcgcgagtgg       240
     gatgacgatg acgattatgg gcgcaagagg cggcgctcga gcatcttcga catcttcgac       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page