(data stored in ACNUC7421 zone)

EMBL: CP000283.PE570

CP000283.PE570       Location/Qualifiers
FT   CDS_pept        646116..646400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0572"
FT                   /product="Protein of unknown function UPF0156"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37810"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM9"
FT                   /protein_id="ABE37810.1"
FT                   /translation="MAGSYKLDEHSEAFVEGLVASGRFETAGDVLRESLRLMEAREAKL
FT                   DALRAEIQQGLDSGPMEEFDPKTLMEDIKRRGRERLAADRAVAAQKRGA"
     atggccggca gctataagct cgacgagcac tccgaggcct ttgtcgaagg tcttgtcgca        60
     agcggccgct tcgagacggc cggagacgtg ctgcgcgaaa gccttcgcct gatggaggcc       120
     cgggaagcga agctggatgc gctgcgcgcc gaaatccagc aggggctcga tagcgggccg       180
     atggaagaat tcgatccgaa gactttgatg gaagacatca agcgacgcgg gcgtgagcgc       240
     ctcgcagccg atcgcgccgt tgccgcccaa aagcgtggcg cataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page