(data stored in ACNUC7421 zone)

EMBL: CP000283.PE574

CP000283.PE574       Location/Qualifiers
FT   CDS_pept        649290..650075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0576"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37814"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM5"
FT                   /protein_id="ABE37814.1"
FT                   /translation="MNASEYLDGVRHLPLGSLSDLTGGAPWVLLSPHPDDESLGAGGLI
FT                   AAACDAGERVDVVLITDGGASHPQSQQYPRQRMIELRRTELENATSILGLPRDQLHHLG
FT                   LPDTQAPTEGPPFEAAVDAIAAICAHAGAKSLFVTWDGDPHCDHEASARIAEAVCRRNP
FT                   GIALWAFPIWGWHLDPSLPLDRPPPRGFRLDISAQRARKRAAINAHVSQMTGLIDDDPN
FT                   GFRFTDDRLAPFLGQFEHYLKVSPHEPKNRDDPGGILRE"
     ttgaacgcat cagagtatct cgacggagtt cgccatctgc cgctgggttc gctgagcgac        60
     ctcaccggcg gcgcgccgtg ggtgttgctg tcgccgcatc ctgatgacga gtcgctcggc       120
     gccggcggat tgatagcagc cgcttgcgac gcgggcgagc gcgtcgacgt cgtcctgatc       180
     accgatggcg gcgcctcaca tccgcagtcg cagcagtatc cccggcaacg aatgatcgaa       240
     ttgcgccgga ccgaactgga aaacgccacg tcgattctcg gtctgccgcg tgaccagttg       300
     catcatctcg gcctgcctga cacccaggcg ccgaccgagg gtccgccgtt cgaggccgcc       360
     gtggatgcaa ttgccgcgat ctgcgcgcac gcgggcgcga aatcgctgtt cgtgacgtgg       420
     gacggcgatc cgcattgcga tcacgaggcc tctgcgcgca ttgccgaggc ggtgtgccgg       480
     cgtaaccctg gcatcgcctt gtgggcgttt ccgatctggg gctggcatct cgatccgtcg       540
     ttgccgctgg accggccgcc gccccgagga tttcgcctcg acatctcggc gcaacgcgcc       600
     cgcaaacgcg ccgcgatcaa cgcccatgtt tcgcagatga ccggtctgat cgacgacgat       660
     ccgaacggct ttcgcttcac cgatgaccgg ctggcgccgt tcctcggcca attcgagcac       720
     tatctgaaag tgtcccccca tgagccgaag aaccgagacg atcccggcgg aatacttcga       780
     gaataa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page