(data stored in ACNUC7421 zone)

EMBL: CP000283.PE586

CP000283.PE586       Location/Qualifiers
FT   CDS_pept        complement(661176..661448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0588"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37826"
FT                   /db_xref="GOA:Q13DL3"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DL3"
FT                   /protein_id="ABE37826.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGIKAYGGEYVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKVEGRVEFRAKANGRTFVSVLPIAAEAAE"
     atggctcata aaaaagcggg cggttcatcg cgaaacgggc gtgattctgc gggcaagcgc        60
     ctcgggatca aggcctatgg cggcgaatac gtgattcccg gcaacatcat cgcgcgtcag       120
     cgcggcacca cctggcaccc cggcctcaac gtcggcatgg gcacggacca caccttgttc       180
     gccaaggtgg aaggccgcgt cgagttccgc gccaaagcca acggccgcac cttcgtatcg       240
     gtacttccga ttgcggcaga ggcggctgaa tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page