(data stored in ACNUC7421 zone)

EMBL: CP000283.PE588

CP000283.PE588       Location/Qualifiers
FT   CDS_pept        662255..663403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37828"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL1"
FT                   /protein_id="ABE37828.1"
FT                   /translation="MAEDTLTTHAGIAVHGAERLPSVDVDSYNIELKDDDGFLGDRASK
FT                   GAFQRILDASRKPLRKNGEDPLGKKATEEISKGTLDDILKGDDVGAAALVHGAIEEFAQ
FT                   ELAFVTRRFLKTKAWADTECIVVGGGFRQSRVGELAIARTDILLKSEGLKVDLVPIRFD
FT                   PDEAGLIGCLHLAPSWIFEGHDSILAVDIGGSNIRCGVVETFWKKAPDLSKASVWKVEL
FT                   WRHAEDEPTREGAVKRLTKMLKDLIADAEKEGFKLAPFIGISCPGVINADGSIEKGAQN
FT                   LPGNWESSKFHLPRSLIEGIPMIGDHDTAILMHNDGVAQGLSEVPFMQEFDRWGVLTIG
FT                   TGLGNARFTNRKTKEKAKKDKAKDDKPKEKEKEKDKERKEKA"
     atggccgagg atacgctgac cacccacgcc ggcatcgccg ttcacggcgc cgagcgactg        60
     ccgtccgtcg acgtcgatag ctacaatatc gagctcaagg acgatgacgg atttctcggc       120
     gaccgcgcca gcaagggcgc attccagcgc atcctcgacg cctcccgcaa gccgctgcgc       180
     aagaacggcg aagatccgct gggcaagaag gcgaccgagg aaatctccaa ggggacgctc       240
     gatgatatcc tgaaaggcga cgacgtcggt gcggctgcgc tggtgcacgg cgcgatcgag       300
     gaattcgccc aggaattggc cttcgtcacc cgccgcttcc tcaagaccaa ggcctgggcc       360
     gacaccgaat gcatcgttgt cggcggcggc ttccgccaga gccgggtcgg cgagctggcg       420
     atcgcgcgca ccgacatcct gctcaaatcc gaggggctga aggtcgatct ggtgccgatc       480
     cggttcgatc cggacgaagc cgggctgatc ggctgcctgc atctggcgcc gtcgtggatt       540
     ttcgaaggcc acgacagcat tctggcggtc gatatcggcg gctcgaacat ccgctgcggc       600
     gtggtcgaga ccttctggaa gaaggcgccg gatctgtcga aggcctcggt ctggaaagtc       660
     gagctgtggc ggcacgccga ggacgagccg acccgcgaag gcgcggtgaa gcggctgacc       720
     aagatgctca aggacctgat cgcagacgcc gagaaggagg gcttcaagct cgcgccgttc       780
     atcgggattt cctgcccggg cgtgatcaat gccgacggct cgatcgagaa gggcgcccag       840
     aacctgccgg gcaattggga aagcagcaaa ttccacctgc cgcgcagcct gatcgagggc       900
     atcccgatga tcggcgacca cgacaccgcg atcctgatgc acaatgacgg cgtcgcccag       960
     gggctgagcg aagtgccgtt catgcaggag ttcgaccgct ggggcgtgct gacgatcggc      1020
     accggcctcg gcaacgcccg cttcaccaac cggaaaacca aggagaaggc caaaaaggac      1080
     aaggccaagg acgacaagcc caaggagaag gaaaaagaga aggacaagga gcgcaaggag      1140
     aaggcgtaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page