(data stored in ACNUC7421 zone)

EMBL: CP000283.PE592

CP000283.PE592       Location/Qualifiers
FT   CDS_pept        complement(671337..672662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0594"
FT                   /product="General substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37832"
FT                   /db_xref="GOA:Q13DK7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK7"
FT                   /protein_id="ABE37832.1"
FT                   /translation="MTDTTTAGLGSDPARKHVNPGEIAIGVIIGRTAEFFDFFVYAIAS
FT                   VIVFPRLVFPFASELTGTLYSFAIFAIAFIARPLGTVIFMAIDRRYGKSAKLILAMLLL
FT                   GTATVAIAFLPGYYEIGAAAIWLLALARAAQGLAWGGAWDGLASLLALNAPKQQRGWYA
FT                   MVPQLGAPLGLIVASALFAYFAGNLSSEDFFGWGWRYPFFVAFAINVVALFARLRMVVT
FT                   PEYSSLFESRELQPSRVLDTLRHDGRNIIIGAFAPLASFALFHMVTVFPLSWVFLFTRE
FT                   SPVRFLIIETIGAMFGVVAIIASGMLADRIGRKPLLMGSAIAIAVFSGFAPQMLDAGPV
FT                   GETAYMILGFILLGLSFGQSSGVIASSFRTTYRYTASALTADLAWLFGAGFAPLVALLL
FT                   ATDFGLISSGAYLLSGAVVTILALWISGLRESNEYRSPSESE"
     atgacagata cgacgacggc gggactcggc tctgatccgg cgcgcaagca cgtcaatccc        60
     ggcgaaatcg ccatcggcgt catcatcggc cgcaccgccg agttcttcga cttcttcgtc       120
     tatgcgatcg cgtcggtgat cgtgtttcca cggctggtgt tcccgttcgc cagcgagctg       180
     accggcacgc tgtattcgtt cgcgatcttc gccatcgcct tcatcgcccg gccgcttggc       240
     accgtgatct tcatggcgat cgaccgccgc tacggcaaaa gcgcgaagct gatcctcgcg       300
     atgctgttgc tcggcaccgc gacggtcgcg atcgcgttcc tgcccggcta ttacgagatc       360
     ggcgcggcgg cgatctggct gctggcgctg gcgcgcgcgg cccagggcct cgcctggggc       420
     ggcgcctggg acggtctggc gtcgctgctg gcgctcaacg cgccgaaaca gcagcgcggc       480
     tggtatgcga tggtcccgca gctcggcgcg ccgctcggcc tgatcgtggc gagtgcgctg       540
     ttcgcctact tcgccggcaa tttgtcttcg gaagacttct tcggctgggg ctggcgctat       600
     ccgttcttcg tcgccttcgc gattaacgtc gtcgcgctgt tcgcgcggct gcgtatggtg       660
     gtaacgccgg aatattcgtc gctgttcgaa agccgcgaat tgcagcccag ccgcgtcctc       720
     gacacgctcc gccacgacgg ccgcaacatt atcatcggcg ctttcgcgcc gctggcgagc       780
     ttcgcgctgt tccatatggt cacggtgttc ccgctgtcct gggtgttcct gttcacgcgc       840
     gaaagcccgg tgcggttcct gatcatcgag accatcggcg caatgtttgg cgtggtggcg       900
     atcatcgcgt ccggcatgct cgccgatcgc atcggccgca agccgctgct gatgggctcg       960
     gcgatcgcaa ttgcggtgtt cagcggcttc gccccgcaga tgctcgatgc cggcccggtc      1020
     ggcgagaccg cctatatgat cctcggcttc atcctgctgg gattgtcgtt cggccagtcg      1080
     tccggcgtga tcgcatcgag cttccggact acctatcgct acaccgcgtc ggcgctgacc      1140
     gccgacctcg cctggctgtt cggcgccggc ttcgccccgc tggtcgcact gctgctcgcc      1200
     accgatttcg gcctgatctc gtcgggcgca tacctgctgt cgggcgcagt ggtgaccatc      1260
     ctggcgctgt ggatcagcgg cctgcgcgaa tccaacgagt accgctcacc atcggaatcg      1320
     gaatag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page