(data stored in ACNUC7421 zone)

EMBL: CP000283.PE596

CP000283.PE596       Location/Qualifiers
FT   CDS_pept        676641..677033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0598"
FT                   /product="cytochrome C oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37836"
FT                   /db_xref="GOA:Q13DK3"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK3"
FT                   /protein_id="ABE37836.1"
FT                   /translation="MTLNSPPVDAHGHDHGHEAHVAAHNHGTLKSYLIGFGLSVVLTAI
FT                   PFWLVMGDVLGNKQATGLVIMAFAAVQIVVHMIYFLHMTTAAEEGWTMMALIFTIVMVV
FT                   IALAGSLWVMHHLTTNMMPAHDMIRR"
     atgaccctca attctccccc cgtcgacgcg cacggccacg accacggcca tgaagcccac        60
     gtggctgccc acaatcatgg gacgctgaag agctacctga tcggcttcgg attgtcggtg       120
     gtgctcaccg ccatcccgtt ctggctggtg atgggcgacg tgctcggcaa caagcaggcg       180
     accgggctgg tgatcatggc gttcgcggca gtgcagatcg tcgtgcacat gatctatttc       240
     ctgcacatga ccaccgcggc cgaagaaggc tggacgatga tggcgctgat cttcaccatc       300
     gtcatggtgg tgatcgcgct ggcgggctcg ctgtgggtga tgcaccatct caccaccaac       360
     atgatgccgg cccacgacat gatccggcgg tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page