(data stored in ACNUC7421 zone)

EMBL: CP000283.PE606

CP000283.PE606       Location/Qualifiers
FT   CDS_pept        complement(687619..688815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0608"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37846"
FT                   /db_xref="GOA:Q13DJ3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ3"
FT                   /protein_id="ABE37846.1"
FT                   /translation="MGPLSGVTILDLTSVLMGPYATQTLADMGANVIKVESPDGDIVRH
FT                   IGPGRTPGMGGMFLNTNRGKRSIVIDLKQDEGRATLLRLAATANVVIYNVRPQAMARLG
FT                   LGYEQFAAANPSIIYVGVFGYGQNGPYAAKPAYDDLIQGAAGVPTLLAAAGDGTPRYVP
FT                   ITIADRIVGLMAVNATLGGLMHQQRTGQGQRIDVPMFESMAEFVLVDHLGGLTYDPPLD
FT                   HGGYARLLSRYRKPYKTSDGYLCVLIYNDKQWRSFFEAIDRNDFLAQPRFANHAARTQH
FT                   IDEIYEEIGGIFLTRTTADWRELLERADIPVMPMHTMESILEDPHLDAVGFFKTLDHPV
FT                   EGRIRQTQVASTWSVTQPQAGGPAPTLGEHARDILGEAGFSTDEIERLGRTKAVHLPG"
     gtgggcccgc tttccggcgt gacgattctc gacctcacct ccgtgctgat ggggccgtat        60
     gcgacccaga ccctcgcgga catgggcgcc aacgtcatca aggttgaaag cccggacggc       120
     gacatcgtcc gccatatcgg cccgggccgg acgccgggca tgggcggcat gtttctcaac       180
     accaatcgcg gcaagcgcag catcgtcatc gacctgaagc aggacgaggg tcgcgcaacc       240
     ctgctgcggc tcgccgcgac agccaacgtc gtgatctaca acgtgcggcc ccaggcgatg       300
     gcgcgcctcg ggctcggcta cgagcagttc gccgccgcca acccgtcgat catctatgtc       360
     ggcgtgttcg gctatggcca gaacgggccc tatgcggcga agccggccta tgacgatctg       420
     atccagggcg ccgccggcgt cccgaccctg ctcgccgccg cgggcgacgg cacgccgcgc       480
     tacgtcccga tcaccattgc cgaccgcatc gtcggactga tggcggtgaa cgccactctc       540
     ggcgggttga tgcatcagca acgcaccggc cagggccagc gcatcgacgt tccgatgttc       600
     gagtcgatgg ccgagttcgt cctggtcgat catctcggcg gcctgaccta cgatccgccg       660
     ctcgaccacg gcggctatgc ccggctgttg tcgcgctatc gcaagccgta caagaccagc       720
     gacggctatc tgtgcgtgct gatctataac gacaaacaat ggcgcagctt cttcgaggcg       780
     atcgaccgaa acgattttct ggcgcagccg cgcttcgcca atcacgcggc gcggacccag       840
     cacatcgacg aaatctacga agaaatcggc ggcatcttcc tgacccgcac caccgcggat       900
     tggcgcgaac tgctggaacg cgccgacatt ccggtgatgc cgatgcacac gatggaatcg       960
     attctcgagg acccgcacct cgacgcggtc ggcttcttca agacgctcga ccatccggtc      1020
     gaagggcgga ttcggcagac gcaggtggcc tcgacctgga gcgtcaccca gccacaggcg      1080
     ggcggccccg cgcccacgct cggcgaacac gcccgcgaca tcctcggcga agccggcttc      1140
     tcgaccgacg agatcgagcg cctcggccgg accaaggcgg tgcatctgcc gggctga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page