(data stored in ACNUC7421 zone)

EMBL: CP000283.PE607

CP000283.PE607       Location/Qualifiers
FT   CDS_pept        689010..690035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0609"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37847"
FT                   /db_xref="GOA:Q13DJ2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ2"
FT                   /protein_id="ABE37847.1"
FT                   /translation="MRRTLGLSVAVSLSVTMALTSAQALELKVADSFPAGHYLVRLMLK
FT                   PWMDDVTKRTNGAVTFSYYPNQQMGKATDLLRLTQSGVVDIGYIAPSYASDKMPLSEVA
FT                   QLPESFSTSCQGTLAYWKSAREGVLAQKEYAPNKIKLLMAVVLPPYQVFTVKNKIESIS
FT                   DIQGLKLRTTGGAQDLTLRALGAVPVRMSAPDAYESLARGTMDGVLFPADSIPSYGLDK
FT                   LVKHATDGVSFGSFIVAYSISQAAWNKLPADVKAAMDEASEAIEPKVCADVDKEQAQTR
FT                   KQLNDAGVAYDPIPDATKAQMKDRLKGVSVEWAAAIDARGKPASEALKEFESLLAASAN
FT                   K"
     atgcgaagaa ccctgggtct gtcagtggct gtgtcgctgt cagtcacgat ggcgctgacg        60
     tcagcgcagg cgctcgagtt gaaggtcgcc gattcgtttc cggccgggca ctatctggtg       120
     cggctgatgc tgaagccctg gatggacgac gtcaccaagc ggaccaacgg cgcggtcacc       180
     ttcagctatt atcccaatca gcagatgggc aaggccacgg atctgctgcg tcttacccag       240
     tcgggtgtcg tcgatatcgg ctacatcgcg ccgtcctatg cgtccgacaa gatgccgctg       300
     tcggaagtgg cgcagctccc ggaatcgttc tcgacgagct gccagggcac gctcgcctat       360
     tggaaaagcg cccgggaggg tgtgctcgcc cagaaggaat acgcgccgaa caagatcaag       420
     ctgctgatgg ccgtggtgct gccgccctat caggtgttca cggtgaagaa caagatcgaa       480
     tccatcagcg acattcaggg cctgaagctg cggaccaccg gcggcgcgca ggacttgacg       540
     ctgcgcgcgc tcggcgcggt gccggtccgg atgtcggcgc cggacgccta tgaatcgctg       600
     gcgcgcggca cgatggacgg cgtgctgttt ccagccgaca gcattccctc ctacgggctc       660
     gacaagctgg tgaagcacgc caccgacggc gtcagcttcg ggtcgttcat tgtggcttat       720
     tcgatcagcc aggcggcgtg gaacaagctg ccggccgacg tcaaggccgc gatggacgag       780
     gcctccgaag cgatcgagcc gaaggtctgc gccgacgtcg acaaggagca ggcgcagacc       840
     cgaaagcaat tgaacgacgc cggggtcgcc tacgatccga ttccggacgc gaccaaagct       900
     cagatgaaag acaggctgaa gggcgtcagc gtggagtggg cggccgcgat cgacgcgcgc       960
     ggcaagccgg cgtccgaagc gctcaaggag ttcgagagtc tgctggccgc gagcgcgaac      1020
     aagtaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page