(data stored in ACNUC7421 zone)

EMBL: CP000283.PE619

CP000283.PE619       Location/Qualifiers
FT   CDS_pept        complement(704612..704827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0621"
FT                   /product="formate dehydrogenase delta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37859"
FT                   /db_xref="GOA:Q13DI0"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DI0"
FT                   /protein_id="ABE37859.1"
FT                   /translation="MSPDRLVYMANQIGTFFRSQGADRAVPGIAEHLRKFWDPRMRTAI
FT                   VAHLDAGGEGLAPDVRAAVEALKTTT"
     atgtcgcctg accggctcgt ctatatggcc aatcagatcg gcacgttctt tcgcagccag        60
     ggcgcggaca gagcggtgcc gggcatcgcc gagcatttga ggaaattctg ggacccgcgg       120
     atgcgcacgg cgatcgtcgc gcatctcgac gcgggcggag aaggtctcgc gcccgacgtg       180
     cgcgcggccg tggaggcgct gaaaacgacg acatag                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page