(data stored in ACNUC7421 zone)

EMBL: CP000283.PE620

CP000283.PE620       Location/Qualifiers
FT   CDS_pept        complement(704817..705644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0622"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37860"
FT                   /db_xref="GOA:Q13DH9"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH9"
FT                   /protein_id="ABE37860.1"
FT                   /translation="MRPTVQTTTTRTWRNGRMQDGARAIPEETPVAISYNGGTHAVMMA
FT                   TPADLEDFAIGFSLSEGVIDTPSQIDTFEIVPLDDGIELRMWIGGAEAERLQQRRRHIA
FT                   GPTGCGLCGVDSITEALRPAAIVGAGGHFAPEQIIAAIEAMPPLQTLNIETRAVHAAAF
FT                   WTSARGIVSLREDVGRHNALDKLAGALARQQIATGDGIVLLTSRVSVEMVQKTAALGAP
FT                   LLVAVSAPTALAVRMAEAAGVTLAAIARADGFEVFSHPGRISGGTHEEATDVA"
     atgcgaccga ctgtccagac caccacgaca agaacctggc gcaacggccg gatgcaggat        60
     ggcgcgcgcg ccatccccga ggagacgccg gtcgcgatca gctacaatgg cggcacccat       120
     gcggtgatga tggcgacgcc ggcggatctc gaggatttcg cgatcggctt cagcctcagc       180
     gaaggcgtga tcgacacccc ctcacagatc gacactttcg agatcgtgcc actcgacgac       240
     ggcatcgaac tgcggatgtg gatcggcggc gctgaagccg aacgcctgca gcagcgccgc       300
     cgccatatcg ccggaccgac cggttgcggg ctgtgcgggg tcgattcgat caccgaggcg       360
     ctgcgcccgg cggcgatcgt cggcgcgggc ggccactttg cgccggagca gatcatcgcc       420
     gcgatcgagg cgatgccgcc gctgcagaca ctgaacatcg aaacccgcgc ggtgcatgcg       480
     gccgcgttct ggacgtcggc gcgcggcatc gtgagcctgc gcgaagatgt cggccgtcac       540
     aatgcgctcg acaagctcgc cggcgcgctg gcgcggcaac agatcgcgac cggcgacggc       600
     atcgtgctgc tcaccagccg ggtgtcggtc gagatggtgc agaagacggc tgcgctcggc       660
     gcgccgctgc tggtcgcggt gtcggcgccg accgcacttg cggttcggat ggcggaggcg       720
     gccggcgtga cgctcgccgc gatcgcgcgc gccgacggat ttgaagtctt ttcccatccc       780
     ggccggatca gcggcggaac ccacgaggaa gctaccgatg tcgcctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page