(data stored in ACNUC7421 zone)

EMBL: CP000283.PE623

CP000283.PE623       Location/Qualifiers
FT   CDS_pept        complement(710058..710528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0625"
FT                   /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37863"
FT                   /db_xref="GOA:Q13DH6"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH6"
FT                   /protein_id="ABE37863.1"
FT                   /translation="MKNEPWDTTRAAEIIAGLTHKEGPTLVILHALQEAFGYVPEAAEP
FT                   MVAQALNLSRAEIHGVVTFYPDFRREPPGRHVLKLCRAEACQAAGGDALAAQAETRLGV
FT                   TFGATSADGAVSLEPVYCLGLCATAPSAMLDDRVIGRLDTHRLDALMTEAQR"
     atgaaaaacg aaccatggga tacgacccgc gccgctgaga tcatcgccgg gttgacgcac        60
     aaggaaggac cgacgctggt gatcctgcac gcgctgcagg aggcgttcgg ctatgtgccg       120
     gaggccgccg agccgatggt ggcgcaggcg ctcaatctgt cgcgcgctga aatccacggc       180
     gtcgtcacgt tctatcccga cttccgccgc gagccgcccg gccgccacgt gttgaagctg       240
     tgtcgcgccg aggcctgcca ggccgccggc ggcgacgcgc tggcggcgca ggccgaaacc       300
     cgcctggggg tgacgttcgg cgccacctcc gcggacggcg cggtgtcgct ggagccggtg       360
     tattgcctcg gcctgtgcgc cacggcgccc tccgcgatgc tcgacgaccg cgtgatcggc       420
     cgcctcgata cgcaccgcct cgatgccttg atgacggagg cgcagcgatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page