(data stored in ACNUC7421 zone)

EMBL: CP000283.PE637

CP000283.PE637       Location/Qualifiers
FT   CDS_pept        complement(726848..727435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0639"
FT                   /product="protein of unknown function DUF1636"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37877"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG2"
FT                   /protein_id="ABE37877.1"
FT                   /translation="MVLWRRRGGVHRTDSRAVAHRSSPRAIRQSSKPQGVAESQGMDRS
FT                   PDHDHTTAPTAELQTDITTDGSTRPAGPVVISVCISCKAADGSNAGAPMLDAIRAAQGG
FT                   AADLRVRPVQCLSVCKRAATVAVSSADGYSFVFGDLVPETGADAIIGFAAAYQHSDYGL
FT                   VPWRQRADVLRKGMVARLPPLRWSPDDGRAPS"
     atggtgcttt ggaggcgtcg gggcggggtg caccggacgg acagcagggc ggtggcgcat        60
     cgatcgtcac cccgcgcgat ccgacaaagc tcgaagccgc aaggcgttgc cgagagccag       120
     ggcatggatc gcagccccga ccacgatcac accaccgcgc caaccgctga gctgcagacc       180
     gatatcacga ctgacggttc cacacggccc gcgggtccgg tggtgatcag cgtctgcatc       240
     agttgcaagg ccgccgacgg cagcaatgcc ggcgcgccga tgctcgacgc gatccgggcc       300
     gcgcagggcg gcgcggccga tctgcgggtg cggccggtgc agtgcctcag cgtctgcaag       360
     cgcgccgcca ccgtcgcggt gtcgagcgcc gacggctaca gcttcgtgtt cggcgatctc       420
     gtccccgaga ccggagccga cgcgatcatc ggcttcgccg ccgcgtatca gcacagcgat       480
     tacggcctgg tgccgtggcg ccagcgcgcc gacgtcctgc gcaaaggcat ggtcgcgcgg       540
     ctgccgccgc tgcgctggtc gcccgacgac gggcgtgcgc cgtcatga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page