(data stored in ACNUC7421 zone)

EMBL: CP000283.PE640

CP000283.PE640       Location/Qualifiers
FT   CDS_pept        729640..729906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37880"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF9"
FT                   /protein_id="ABE37880.1"
FT                   /translation="MTTSRIHIIGIATIAAMGLLAGPALASNQGPQGSVSEPPSAGCSS
FT                   YMKAPDGSWTKIPCAEAGARAAAAKRNNTRTSAQSQDRSESQD"
     atgacgacat cacgcatcca tatcatcggc atcgcgacga tcgccgcgat gggcctgctg        60
     gccgggccgg cgctggcaag caatcagggg ccacagggca gcgtcagcga gccgccctcg       120
     gcgggctgca gctcctacat gaaggcgccc gacggcagct ggaccaagat cccgtgcgcg       180
     gaggccggcg caagagcggc cgcggccaag cgcaacaaca cgcggacatc ggcacaatcc       240
     caggatcgat ccgaatctca agattga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page