(data stored in ACNUC7421 zone)

EMBL: CP000283.PE642

CP000283.PE642       Location/Qualifiers
FT   CDS_pept        complement(730592..730804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37882"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF7"
FT                   /protein_id="ABE37882.1"
FT                   /translation="MPIYGYVCNKCGHGFETLLYAHETAACPSCESTDLDQQLSLIAKP
FT                   AKGGPDVPMCDGAGGCGRCSPDLCA"
     atgccgatct acggttatgt ctgcaacaaa tgtggccacg gcttcgagac gctgctgtat        60
     gcgcatgaga ccgcggcctg cccgagctgc gagagcaccg atctcgacca gcaattgtcg       120
     ctgatcgcca agccggccaa aggcggcccg gacgtgccga tgtgcgacgg cgccggcgga       180
     tgcggccgct gctcgccgga cctctgcgcg tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page