(data stored in ACNUC7421 zone)

EMBL: CP000283.PE644

CP000283.PE644       Location/Qualifiers
FT   CDS_pept        complement(731296..731760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0646"
FT                   /product="protein of unknown function DUF123"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37884"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF5"
FT                   /protein_id="ABE37884.1"
FT                   /translation="MPQPQLAQCPDRKGAYVVALAIAAPIEIRLGKAAPAVLRAGRYLY
FT                   CGSAYGPGGLRARLGRHFRKTKTLRWHVDRLTTAGEVRGAWAITQGDECELVRRLGFLT
FT                   APIDGFGASDCAHCRSHLLRWPQRIPRSAIVAALAADRSAAPVWLRAERE"
     atgccgcaac cgcaactcgc tcaatgtccc gaccgcaaag gcgcttacgt cgtcgcgctg        60
     gcgatcgccg cgccgatcga gattcggctc ggcaaggccg cgccggcggt gctgcgcgcc       120
     gggcgctatc tgtattgcgg ctcggcctat ggtcccggcg gattgcgcgc gcggctcggc       180
     cggcattttc gcaagaccaa gaccctgcgc tggcatgtcg atcgtttgac cacagccggc       240
     gaggtgcgcg gcgcctgggc gatcacgcaa ggcgatgaat gcgagctggt gcgccggctc       300
     ggctttctta ccgctccgat cgacgggttc ggcgccagcg attgcgcgca ttgccgcagc       360
     catctgctgc gctggccgca gcgcatcccc cgctcggcga tcgtcgcggc gctcgccgcc       420
     gatcgcagcg ccgctccggt ctggctgcgc gccgagcgtg aatga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page