(data stored in ACNUC7421 zone)

EMBL: CP000283.PE645

CP000283.PE645       Location/Qualifiers
FT   CDS_pept        complement(731828..732022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37885"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF4"
FT                   /protein_id="ABE37885.1"
FT                   /translation="MKARDSGQFRHLSPDELECLAAAEWAQAEAMSDDLKDLVMKSANA
FT                   MHARAKLKRILLSQVPTKH"
     atgaaagcgc gagactcggg acaatttcgc catttgtcgc ccgacgaatt ggaatgtctc        60
     gccgcggccg aatgggcgca ggccgaggcg atgtcggacg acctcaagga cctggtgatg       120
     aaatccgcca acgcgatgca cgcgcgcgcc aagctcaagc ggatcctgct gagccaggtg       180
     ccgaccaagc actga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page