(data stored in ACNUC7421 zone)

EMBL: CP000283.PE647

CP000283.PE647       Location/Qualifiers
FT   CDS_pept        733338..733526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37887"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF2"
FT                   /protein_id="ABE37887.1"
FT                   /translation="MVDGEDDDALAPDDFPIEAEQTALKTQDGETIAQAKTKQIAENIA
FT                   QRLNEQADREEEDRWSA"
     atggtggacg gtgaagacga cgacgcgctc gcgcccgacg attttccgat cgaagccgag        60
     cagacggcgc tgaagacgca ggacggcgag accatcgcgc aagccaagac caagcagatc       120
     gccgaaaaca tcgcgcagcg tctcaacgaa caggcggacc gcgaggaaga ggatcgctgg       180
     tcggcgtga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page