(data stored in ACNUC7421 zone)

EMBL: CP000283.PE662

CP000283.PE662       Location/Qualifiers
FT   CDS_pept        748667..749272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0664"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37902"
FT                   /db_xref="GOA:Q13DD7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DD7"
FT                   /protein_id="ABE37902.1"
FT                   /translation="MLKEIRPALVVLVVLTVICGLAYPLAMTGIAGVLFPEQAAGSLIV
FT                   KDGAVIGSALIGQEFKDDKYFHGRPSATSAADPADPTKTVSSPYNAANSSGSNLGPTSK
FT                   ALNDRVKEDVDKLKAENPSAAVPVDLVTASGSGLDPEISPEAALFQVPRVARARGLSED
FT                   GVRKLVNAQTKGRFAGLLGEPRVNVLALNLALDATTRK"
     atgttgaaag aaattcgccc cgcactcgtc gttctcgtcg tgctgacggt catctgcggt        60
     cttgcctatc cgctggccat gaccggtatc gccggggtgc tgttcccgga gcaggccgcc       120
     ggaagcctga tcgtcaagga cggcgccgtg atcggttcgg cgctgatcgg ccaggagttc       180
     aaggacgaca agtacttcca cggccgcccg tcggcgacct cggcggctga ccccgccgat       240
     ccgaccaaga cggtgtcatc gccctacaac gccgccaact ccagcggctc caatctcggg       300
     ccgaccagca aggcgctgaa cgaccgcgtc aaggaagacg tcgacaagct caaggccgag       360
     aacccctcgg ccgcggtgcc ggtcgatctg gtcaccgcct cgggcagcgg actcgacccc       420
     gagatttcgc cggaggccgc tttgtttcag gtgccgcgcg tcgcccgtgc ccgcggtctg       480
     tctgaagacg gcgtccgcaa gctggtgaac gcgcagacca agggccgctt cgccggcctg       540
     ctcggtgagc cccgcgtgaa cgtgcttgcg ctcaatctgg cgctggatgc gaccaccagg       600
     aagtag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page