(data stored in ACNUC7421 zone)

EMBL: CP000283.PE68

CP000283.PE68        Location/Qualifiers
FT   CDS_pept        83786..84514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0068"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37308"
FT                   /db_xref="GOA:Q13F31"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F31"
FT                   /protein_id="ABE37308.1"
FT                   /translation="MPNAGLARIGGPIRQKRRRAQLTRPGRSRISRANCPRWPGSTGAV
FT                   HFLGCLRLICEPHHRAYLNLLNNLPGLRRTTREADLSTEQIGAQAPSRLSCPSCHRWWP
FT                   KGAGGAPRPRTQASERLSGPSRDQIMDRLRQRADFIAVAGGLRISGPAFVLQGRRRDDE
FT                   GPVRVGFTVTKKIGTATERNRIRRRMRELVKRADRSFMLPNSDYVLVGRRAALSRDFAV
FT                   MLGDLRSALDRIARRSSKPD"
     atgcctaacg ccggcttggc gagaatcggc ggaccgatcc ggcaaaagcg gcgtcgcgcg        60
     caattgacga gaccaggtcg gtcccgtata agccgcgcca actgtccgcg atggcccggc       120
     tcgaccgggg cggttcattt tttgggctgc ttacggctca tctgtgagcc tcatcatcgg       180
     gcttacctca atcttctgaa taacttaccc ggcctgcgga gaacgacccg tgaagcggac       240
     ttatcaaccg agcaaattgg tgcgcaagcg ccgtcacggc tttcgtgccc gtcttgccac       300
     cgctggtggc cgaaaggtgc tggcggcgcg ccgcgcccgc ggacgcaagc gtctgagcgc       360
     ctgagcgggc catcccgaga tcagatcatg gaccggttac ggcagcgggc ggacttcatc       420
     gccgttgccg gcgggctgcg gatcagtggg cctgccttcg tgctgcaagg ccgacgccgc       480
     gatgacgaag gcccggtccg ggtcgggttc accgtgacca aaaagatcgg caccgcgacc       540
     gagcgcaacc ggattcgccg cagaatgcgc gaattggtca agcgcgcgga ccgcagtttc       600
     atgctgccaa acagcgatta tgtgctggtc ggccgccgtg cggcgttgag ccgcgacttt       660
     gctgtcatgc tcggcgattt gcgctccgcg ctcgaccgca ttgcgcggcg atcgtcgaaa       720
     ccggattga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page