(data stored in ACNUC7421 zone)

EMBL: CP000283.PE69

CP000283.PE69        Location/Qualifiers
FT   CDS_pept        84531..86396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0069"
FT                   /product="protein translocase subunit yidC"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37309"
FT                   /db_xref="GOA:Q13F30"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F30"
FT                   /protein_id="ABE37309.1"
FT                   /translation="MTDNRNTILAVILSGLVLLGWQYFFNIPQMEKQRAAQQAQQQQEA
FT                   AKQQTPPAATTPGAPNAPAAPGAPGAPANQPAANAPVVSRDAAIAASPRIKVETPRLDG
FT                   TLSLKGARIDDLSLSQYHETVDPKSAPIHLFSPSGSANPYYAEFGWVGAAGSNVKLPDQ
FT                   NTLWEQEGSGALTPANPVTLKWDNGEGLTFRRQIAVDDRYLFTIKDDVTNVGGGPVTLY
FT                   PFALISRHGTPHVEGFYILHEGLIGYLGEQGLQEYGYAKIDEAKTVGFKATNAWMGITD
FT                   KYWASALLPDTNAQLQARFSSNQVGATRTYQTDYLEDAKTVPIGGTATATARLFAGAKE
FT                   ARVVGINFPFAGLGGYNQQLGLNHFDLLIDWGWFYFITKPMFLALDFFFHLVGNFGVAI
FT                   LLVTVLVKLIFLPLANKSYASMAKMKAIQPQLLALKERHPDDKAKQQQEMMEIYRKEKI
FT                   NPVAGCLPVLLQIPVFFSLYKVLFVTIEMRHAPFFGWIHDLSAADPTNLFNLFGLIPYD
FT                   PSTLPVIGSYLVLGVWPLVMGFTMWFQMKLNPQPPDPTQQMIFAWMPVIFTFMLAHFPA
FT                   GLVIYWAWNNTLSVIQQAYIMRRNGVKVELWDNLKSAVVKPKKTA"
     atgaccgaca atcgcaacac catcctcgcc gtgattctgt cgggcctcgt gttgctcggc        60
     tggcagtact tcttcaacat cccgcagatg gagaagcagc gcgccgcaca gcaggcgcag       120
     cagcagcaag aggctgccaa gcagcagacc ccgccggcgg ccacgactcc cggcgcgccg       180
     aatgctccgg cggctccggg tgctccgggc gcgcctgcca accagccggc cgccaatgcg       240
     ccggtggtca gccgtgacgc cgcgattgcg gcctcgccgc ggatcaaggt cgagaccccg       300
     cggctcgacg gcacgctgtc gctgaagggc gcgcggatcg acgatctgtc gctgagccag       360
     taccacgaaa ccgtcgatcc gaagtcggcg ccgatccatc tgttctcgcc gtccggcagc       420
     gccaatccct actacgccga gttcggctgg gtcggcgccg cgggctcgaa cgtcaagctg       480
     cccgaccaga acacgctgtg ggagcaggaa ggcagcggcg cgctgacgcc ggccaatccg       540
     gtaacgctga aatgggacaa cggcgagggc ctcaccttcc gccgccagat cgcggtcgac       600
     gatcgctact tgttcacgat caaggacgac gtcaccaatg tcggcggcgg cccggtgacg       660
     ttgtatccgt tcgcgctgat ctcgcgccac ggcaccccgc atgtcgaagg cttctacatc       720
     ctgcatgaag gcctgatcgg ctatctcggc gagcagggtc tgcaggaata cggctacgcc       780
     aagatcgacg aagccaagac ggtcggtttc aaggccacca acgcctggat gggcatcacc       840
     gacaaatact gggcgtcggc gctgctgccc gacaccaatg cgcagcttca ggcgcggttc       900
     tcttcgaacc aggtcggcgc cacccggacc taccagaccg actatctcga agacgccaag       960
     accgttccga ttggcggcac cgccaccgcg accgcgcggc tgttcgcggg cgccaaggaa      1020
     gcgcgcgtcg tcggcatcaa cttcccgttc gcggggctcg gcggctacaa ccagcagctc      1080
     gggctgaacc atttcgacct gctgatcgac tggggctggt tctacttcat caccaagccg      1140
     atgttcctcg cgctcgactt cttcttccac ctggtcggga atttcggcgt cgccattctg      1200
     ctggtgacgg tactggtcaa gctgatcttc ctgccgctgg cgaacaagtc ctacgcctcg      1260
     atggcgaaga tgaaagcgat ccagccgcaa ttgcttgcgc tgaaagagcg tcatccggac      1320
     gacaaggcga agcagcagca ggagatgatg gagatctacc gcaaggagaa gatcaatccg      1380
     gtcgccggct gtctgccggt gctgctgcag atcccggtgt tcttctcgct gtacaaggtg      1440
     ttgttcgtca ccatcgaaat gcggcacgcg ccgttcttcg gctggatcca cgacctctcg      1500
     gcggccgatc cgaccaacct gttcaatctg ttcggtctga ttccctatga tccaagcacg      1560
     ctgccggtta tcgggtcgta tctggtgctc ggcgtctggc cgctggtgat gggcttcacg      1620
     atgtggttcc agatgaagct caacccgcag ccgccggatc cgacgcagca gatgatcttc      1680
     gcctggatgc cggtgatctt caccttcatg ctggcgcact tcccggcggg tctcgtgatc      1740
     tactgggcct ggaacaacac gctctcggtg atccagcagg cctacatcat gcgccgcaac      1800
     ggcgtgaagg tggagctgtg ggacaatctg aaatccgccg tcgtcaaacc aaagaagacg      1860
     gcctga                                                                 1866
//

If you have problems or comments...

PBIL Back to PBIL home page