(data stored in ACNUC7421 zone)

EMBL: CP000283.PE7

CP000283.PE7         Location/Qualifiers
FT   CDS_pept        complement(8751..9092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37247"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F92"
FT                   /protein_id="ABE37247.1"
FT                   /translation="MIRTVAALIVLLLNAEVRSETVDVKYRGPVDLRTFECRDITRSSF
FT                   IQRVCYDQAQAYMIISLKGTYYHYCELSRATFDSLMGAPSMGQFFNQTIKGTGSDGPFD
FT                   CRTHRTPSY"
     atgatcagga ccgtagcggc gctcatcgtt ctcctgctca acgcggaagt gcgttcagag        60
     actgtcgacg tcaaatatcg cgggccggtc gacctcagga ccttcgagtg ccgggacatc       120
     actcgcagca gtttcatcca gcgggtctgt tacgatcagg cgcaggccta catgatcatc       180
     agcctcaaag gcacatacta tcactactgc gagttatcgc gggcgacgtt cgacagcctg       240
     atgggtgcgc cgtcgatggg gcaattcttc aatcagacca tcaaggggac cggcagcgac       300
     ggcccgtttg actgccggac acaccggacg cccagctatt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page