(data stored in ACNUC7421 zone)

EMBL: CP000283.PE72

CP000283.PE72        Location/Qualifiers
FT   CDS_pept        87857..88816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0072"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37312"
FT                   /db_xref="GOA:Q13F27"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F27"
FT                   /protein_id="ABE37312.1"
FT                   /translation="MLAVLPANRSENPTTQRKTRFMTDAPVISPIDQARILSEALPHMQ
FT                   RYDEETIVIKYGGHAMGAENDAKAFARDIVLLEQTAVNPVVVHGGGPQIATMLKRLGIK
FT                   SEFAAGLRITDGATIEIVEMVLAGSINKQLVGYINEAGGKAVGLCGKDGNMVTASKATR
FT                   TMVDPDSRIEEVVDLGFVGEPEKVDLTLLNQLIGHELIPVLAPLATSATGQTFNVNADT
FT                   FAGAVAGALKAKRLLLLTDVPGVLDKSKQLIPELSIKDARKLIADGTISGGMIPKVETC
FT                   IYALEQGVEGVVILDGKVPHAVLLELFTNQGTGTLIHK"
     atgctagcgg ttctccccgc caaccgttcc gagaatccta cgacacagcg aaagacccgc        60
     ttcatgaccg acgcgcccgt tatcagcccg atcgatcagg cccggatcct gtccgaggcg       120
     ctcccgcata tgcagcgcta tgacgaggaa accatcgtca tcaaatatgg cggccacgcc       180
     atgggcgccg aaaacgacgc caaggccttc gcccgcgaca tcgttctgct cgagcagacc       240
     gcggtcaatc cggttgtggt gcatggcggc ggtccgcaga tcgccaccat gctgaagcgc       300
     ctcggcatca agtcggaatt cgccgccggg ctgcgcatca ccgacggcgc cactatcgag       360
     atcgtcgaga tggtgctggc cggctcgatc aacaagcaac tggtcggcta catcaacgag       420
     gccggcggca aggcggtcgg cctgtgcggc aaggacggca acatggtcac tgcctccaag       480
     gcgacccgca ccatggtcga tccggattcg cggatcgagg aggtggtcga tctcggcttc       540
     gtcggcgaac cggagaaggt cgatctgacg ctgctgaacc agctgatcgg gcacgagctg       600
     atcccggtgc tggcgccgct cgccacttcg gccaccggcc agaccttcaa cgtcaacgcc       660
     gacaccttcg cgggcgcggt cgccggcgcg ctgaaggcga aacggttgtt gttgctgacc       720
     gacgtgcccg gcgtgctcga caagtcgaag cagctgatcc ccgagctgtc gatcaaggac       780
     gcgcgcaagc tgatcgccga cggcaccatc tccggcggca tgatcccgaa ggtcgagacc       840
     tgcatctacg cgctcgaaca gggcgtcgaa ggcgtcgtca tcctcgacgg caaggtcccg       900
     cacgcggtgc tgctcgaatt gttcaccaat cagggcaccg gcacgctgat ccacaagtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page