(data stored in ACNUC7421 zone)

EMBL: CP000283.PE73

CP000283.PE73        Location/Qualifiers
FT   CDS_pept        88816..89970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0073"
FT                   /product="Peptidoglycan-binding domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37313"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F26"
FT                   /protein_id="ABE37313.1"
FT                   /translation="MTGAKATSSCPGRGAARSAAPQTRDPGSAEPHKPGPRIISAPRRE
FT                   GRRAALHPGHACLFVATLLASLAGNTAAHADLKLCNRMSYVIETAIGIDDKATTATRGW
FT                   LRIDPAQCRVVLQGALSADRVMLHARALAVYGASPIPQNGTDRLCITPENFVIAAARQC
FT                   RSGQTLAPFTEIKPTQQDDGNMVAYLAEDSEYDDEQARLAAIQRLLVIAGYDAAPIDGV
FT                   DGPKTQAALAAFLKSRGLKPDIVSAPDFFDTMIKAVESPSATGLTWCNDTRSRIMAAIA
FT                   EDDGKTITSRGWYRIEPGKCLRPDLSALPKRVFSFAEAVDGNARPITLKDKPLNWGGAT
FT                   LLCTRESKFEISEQGDCSARGLNATGFAPVDLSGGGKTVRFATP"
     atgacgggcg caaaggccac cagttcgtgt cccgggcgcg gcgcagcacg aagtgctgca        60
     ccgcagaccc gggaccccgg ttcggctgag ccacacaaac cgggaccccg gatcatcagc       120
     gcaccacgcc gcgaagggcg gcgcgctgcg ctgcatccgg ggcacgcttg tcttttcgtc       180
     gcaacactac tcgcatcatt ggctggcaac accgccgccc atgccgacct caagctctgc       240
     aaccgcatga gctatgtgat cgagaccgcg atcgggatcg acgacaaggc gacgaccgcg       300
     acgcgcggct ggctccggat cgatccggcg caatgccgcg tcgtgctgca aggggcgctg       360
     agcgccgatc gggtgatgct gcatgcccgc gcgctcgcgg tttacggcgc gtcgccgatc       420
     ccccagaacg gcactgaccg actatgtatc acgccggaga acttcgtgat cgccgccgca       480
     cggcagtgcc gcagcggcca gacgctggcg ccgttcaccg agatcaagcc gacgcagcag       540
     gacgacggca acatggtcgc gtacctcgca gaggacagcg aatatgacga cgagcaggcc       600
     aggctcgcgg cgatccagcg gctgctggtg atcgcgggct acgacgccgc cccgatcgac       660
     ggcgtcgatg gcccgaagac gcaagccgcg ctcgccgcgt tcctgaaaag ccgcggcctc       720
     aagcctgaca tcgtcagcgc gccggacttc ttcgacacca tgatcaaggc ggtggagtcg       780
     ccatcggcga ccggcctgac ctggtgcaac gacaccagga gcaggatcat ggccgcgatc       840
     gccgaggacg acggcaagac catcaccagc cgcggctggt accggatcga gccgggcaaa       900
     tgcctacgtc ccgacctcag cgccctgccg aagcgggtgt tcagcttcgc cgaagcggtc       960
     gacggcaatg cacgcccgat caccctcaag gacaagccgc tcaactgggg cggcgcgacg      1020
     ctgctgtgca cgcgcgagag caaattcgag atcagcgagc agggcgactg ctcggcgcgc      1080
     ggactgaacg ccaccggctt tgcgccggtc gacctctccg gcggcggcaa gacagtgcgg      1140
     tttgcgacgc catga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page