(data stored in ACNUC7421 zone)

EMBL: CP000283.PE76

CP000283.PE76        Location/Qualifiers
FT   CDS_pept        91810..92097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37316"
FT                   /db_xref="GOA:Q13F23"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F23"
FT                   /protein_id="ABE37316.1"
FT                   /translation="MELLMAEFRRIIIKTAEVMMVLLVIITILATAGLGAISGSETSGA
FT                   LAVAGFVLGGVGGLIVSSIFASSFFLILEIAENTRQVLRYYEPKVDGASR"
     atggagcttc tcatggctga attccgtcgg atcatcatca agactgctga agtcatgatg        60
     gttctacttg tcatcataac aattctcgcg acagcaggtc tcggtgcaat ctccggcagc       120
     gagaccagcg gagcactcgc tgtggctggt ttcgtgctgg gtggggtcgg cggtctgatc       180
     gtctcgtcaa tcttcgcgtc atcgttcttc ctcattctcg aaatcgccga aaacacccgg       240
     caggtgctga gatactacga gcccaaagtt gacggcgcga gccgctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page