(data stored in ACNUC7421 zone)

EMBL: CP000283.PE81

CP000283.PE81        Location/Qualifiers
FT   CDS_pept        complement(96621..97148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0081"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37321"
FT                   /db_xref="GOA:Q13F18"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F18"
FT                   /protein_id="ABE37321.1"
FT                   /translation="MALREIIILPDKRLREISKPVAEVTPEIRKLADDMFESMYDAPGI
FT                   GLAAIQIAEPVRLITMDIVRKEGNGKSDPRAFINPEIVGASAEMNVYEEGCLSIPEYYA
FT                   DVERPAVVRIRYTDLDGNVKEEDADGLFATCIQHEIDHLDGVLFVDHLSKLKRAMVVRK
FT                   FEKAAKRGIKYV"
     atggccctgc gtgaaatcat catcctgccg gataagcggc tgcgtgaaat ctcaaagccc        60
     gtcgccgagg tgacgccgga gatccgcaag ctcgcggacg acatgttcga gagcatgtac       120
     gacgcgcccg gcatcgggct cgcggcgatt cagatcgccg agccggtgcg gctcatcacg       180
     atggacatcg tgcgcaagga gggcaacggc aagagcgatc cgcgcgcctt catcaatccg       240
     gaaatcgtcg gcgcctcggc ggagatgaac gtctacgagg aaggctgcct gtcgatcccc       300
     gaatattacg ccgatgtcga gcggccggca gtggtccgga tccgctacac cgatctcgac       360
     ggcaacgtga aggaagagga cgccgacggc ctgttcgcga cctgcatcca gcacgaaatc       420
     gaccacctcg acggcgtgct gttcgtcgac catctgtcga agctgaagcg cgccatggtc       480
     gtgcgcaagt tcgagaaggc cgccaagcgc ggtatcaaat acgtctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page