(data stored in ACNUC7421 zone)

EMBL: CP000283.PE82

CP000283.PE82        Location/Qualifiers
FT   CDS_pept        97298..98515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0082"
FT                   /product="protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37322"
FT                   /db_xref="GOA:Q13F17"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F17"
FT                   /protein_id="ABE37322.1"
FT                   /translation="MNETLFYLGDAPVSIGAALFGASAMALLLLLAIVLVIAHGLQSGS
FT                   AAALAQARRASDLEQRLSGLIRFQSEANGRVDAMGRALAGRQAEMARAVSERLDTVTHR
FT                   VGQSMTQSTRHTMESLQALHERLGIIDRAHDNLTELTDQVTSLRDVLANKQARGAFGQA
FT                   RMESIVQDGMPKGAYAFQYTLSTGKRPDCVVFLPDQRPLCIDAKFPLEAVTALRESRSD
FT                   GEKKAASQRLRLDVMRHVDDIAAKYLIPGETQDTALMFVPSESVYAEIHDGFDDVIQRA
FT                   YRARIVLVSPSLLMLAIQVMQQILKDARMRDAADQIRTEVLSLGDDLARLRERVTKLQT
FT                   HFGQVNDDVRQILISADKIERRAVRIEELDFSAVEPSTGTQAPLAPEARDLFASRAFKI
FT                   DEVASD"
     atgaacgaga ccctcttcta tcttggcgac gctccggtca gcattggcgc ggcgctgttc        60
     ggcgcgagcg cgatggcgtt gctgttgctg ctggcgatcg tgctggtgat cgcgcacggg       120
     ctgcagagcg gcagcgccgc ggccctggcg caggcccgcc gcgcctctga cctggagcaa       180
     cgcctgtcgg gcctgatcag gttccagagc gaagccaatg gccgggtcga cgcgatgggc       240
     cgggcgctgg cggggcggca ggccgaaatg gcgcgcgcgg tcagcgagcg gctggatacg       300
     gtcacccacc gggtcggcca gtcgatgacg caatcgaccc gccacaccat ggaaagcctg       360
     caggcgctgc acgagcggct cggcatcatc gatcgcgccc acgacaacct caccgagctg       420
     accgaccagg tgacgtcgct gcgcgacgtg ctcgccaaca agcaggctcg cggcgcgttc       480
     ggccaggcgc ggatggagtc gatcgtgcag gacgggatgc cgaagggcgc ctacgccttc       540
     cagtacacgc tctccaccgg caagcggccg gattgcgtgg tgttcctgcc cgaccagcgg       600
     ccgctgtgca tcgacgccaa gtttccgctc gaggcggtca ccgcgctccg cgaatcccgc       660
     agcgacggag agaagaaggc ggcgtcgcag cggctgcggc tcgacgtgat gcggcatgtc       720
     gacgatatcg cggccaagta tctgatcccc ggcgagaccc aggacaccgc gttgatgttc       780
     gtgccatcgg aatcggtcta tgccgagatc catgacggct tcgacgatgt gatccagagg       840
     gcatatcgcg cccgcatcgt gctggtgtcg ccgtcgttgc tgatgctggc gatccaggtg       900
     atgcagcaga ttctgaaaga cgcgcggatg cgcgatgccg ccgatcaaat ccgaaccgaa       960
     gtgctgagcc tcggcgacga tctcgcgcgg ctgcgcgagc gtgtcaccaa gctgcaaacc      1020
     catttcggcc aggtcaacga tgacgtccgc cagatcctga tctcggccga caagatcgaa      1080
     cgccgcgccg tgcggatcga ggaactggat ttttccgcgg tcgaaccgtc gaccggcacg      1140
     caagcgccgc tggcgccgga agccagagac ctgttcgcgt cccgcgcgtt caagatcgac      1200
     gaagtcgctt cagactga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page