(data stored in ACNUC7421 zone)

EMBL: CP000283.PE86

CP000283.PE86        Location/Qualifiers
FT   CDS_pept        complement(101293..101613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0086"
FT                   /product="conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37326"
FT                   /db_xref="GOA:Q13F13"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F13"
FT                   /protein_id="ABE37326.1"
FT                   /translation="MADFLGMMKQAAQLQSKMKAMQAELDQIEVEGSSGGGLVQVRMSA
FT                   KMEVRGVSIDPSLLKPDEGGVLEDLLVAAHADAHRKAEAAMQEKMQALTGGLGLPPGLG
FT                   LG"
     atggctgatt tcctcggcat gatgaaacag gcggcgcagc tgcagtcgaa gatgaaggcg        60
     atgcaggcgg aactcgacca gatcgaggtc gagggctcgt ccggcggcgg cctcgtccag       120
     gtgcggatga gcgcgaagat ggaagtgcgc ggggtctcga tcgacccgtc gctgctgaag       180
     cccgacgagg gcggagtgct ggaagatctt ctggttgcgg cgcatgccga cgcgcatcgc       240
     aaggcggagg ccgcgatgca ggagaagatg caggcgctga ccggcggcct cggcctgccg       300
     cccggcctcg gcctgggtta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page