(data stored in ACNUC7421 zone)

EMBL: CP000283.PE88

CP000283.PE88        Location/Qualifiers
FT   CDS_pept        103996..104481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0088"
FT                   /product="histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37328"
FT                   /db_xref="GOA:Q13F11"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F11"
FT                   /protein_id="ABE37328.1"
FT                   /translation="MDVSGSVPATTQEPACQRADGIDMPSDWSLSSQLEKDTINIGDLP
FT                   LSRVLVIKDAHYPWLLLVPRRADAVEIIDLDEVEQAQLMTEISRVGRALKEITKCDKLN
FT                   IAALGNMVPQLHVHIIARRSSDAAWPRPVWGVMPPLPHDPEEVQQFISALRRKIWLG"
     atggatgtgt cggggtccgt acccgcaacc acgcaagagc ccgcttgcca acgggccgat        60
     ggaatcgaca tgccctccga ctggtcgctg agttctcaac tcgagaaaga caccatcaac       120
     atcggcgacc tgccgctcag ccgcgtgctg gtgatcaagg acgcgcatta tccgtggctg       180
     ctgctggtgc cgcgtcgcgc tgacgcggtc gagatcatcg atctcgacga ggtcgagcag       240
     gcgcagctga tgaccgagat ctcccgggtc gggcgcgcgc tcaaggagat caccaaatgc       300
     gacaagctga acatcgcagc gctcggcaac atggtgccgc agctgcatgt ccacatcatc       360
     gcgcgccgct cgagcgacgc cgcctggccg cgcccggtgt ggggggtgat gccgccgctg       420
     ccgcacgatc cagaggaagt gcagcaattc atcagcgcgc tccggcgcaa gatctggctg       480
     ggctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page