(data stored in ACNUC7421 zone)

EMBL: CP000283.PE92

CP000283.PE92        Location/Qualifiers
FT   CDS_pept        complement(107176..107604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0092"
FT                   /product="protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37332"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F07"
FT                   /protein_id="ABE37332.1"
FT                   /translation="MPSAAEMIARLKLQPHPEGGHFRETFRDPRCDASGRSFSTAIYFL
FT                   LASGERSHWHRIDAIEVWHYYAGAALALEIADADGHRAIRLGPDVAAGEQPQAIVPPHA
FT                   WQAAVTTGDWTLVGCTVAPGFAFEHFELAPPDWSPLRR"
     atgccgtcgg cggccgagat gattgcgcgg ctgaagctgc agccgcatcc cgaaggcggc        60
     cattttcgcg agacctttcg cgacccgcgc tgcgacgcct ccggccgcag cttctcgacc       120
     gcgatctact tcctgctggc gagcggcgag cgctcgcact ggcaccgcat cgatgcgatc       180
     gaggtctggc actattacgc cggcgcggcg ctggcgttgg agatcgccga cgccgacggc       240
     catcgcgcga ttcggctcgg ccccgatgtc gcggccggcg aacagccgca ggcgatcgtg       300
     ccgccgcacg cctggcaggc tgcggtcacg accggcgact ggaccctggt cggctgcacg       360
     gtggcgcccg gcttcgcgtt cgagcatttc gaactggcgc cgccggactg gtcgccgctt       420
     cgccgctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page