(data stored in ACNUC7421 zone)

EMBL: CP000283.PE98

CP000283.PE98        Location/Qualifiers
FT   CDS_pept        complement(112658..114925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0098"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37338"
FT                   /db_xref="GOA:Q13F01"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F01"
FT                   /protein_id="ABE37338.1"
FT                   /translation="MRSTSGGPRVLLRRLRETMAEQVSAQERLDKIVVLIAANMVAEVC
FT                   STYVLRVDNTLELYATEGLNREAVHQTVLNAHEGLVGLVASEATPLNLSDAQSHPAFSF
FT                   RPETGEEIYHSFLGVPILRAGNTLGVLVVQNRAKRTYVEEEVEALQTTAMVLAEMIASG
FT                   ELSALAQPGAEPAARHSIHKTGAILSDGIALGHVVLHEPRVVITNYIAEDLPKEIKRLD
FT                   AALAKLRADLDRLLERGDVADGGEHREVLEAYRMFANDHGWSHRLHEAVATGLTAEAAV
FT                   ERVQSDTRARMLRSTDPYLRDRLHDLEDLGHRLMRQLVGQNHAPSREQLPDNAILIARS
FT                   MGPAALLDYDRTRLRGLVLEEGTANSHVSIVARALGIAAVGEVPNAPGIADPGDAIIVD
FT                   ATSGSIYVRPSAEVEAAYGERVRFRARRQAQYSALRDLACVTKDGQPIDLMINAGLAID
FT                   LPHIDDTGSSGIGLFRTELQFMIGQSLPRSSDQLALYRTVLDAAGSKPVTFRTLDIGGD
FT                   KALPYMETVVEENPALGWRAIRLGLDRPGLLRSQIRALLRAGGGRSLRIMFPMISEVAE
FT                   FDAAKAIVERELTYLRQHGHTLPERVDVGTMVEVPALLYQLDELLKKVDFISVGSNDLF
FT                   QFLYAVDRGNSKVSDRFDTLSTPILRALRHIVRKAKAANRSVSLCGEMASQPLSALALI
FT                   AIGYRALSVSAVSHGPIKAMILEVDAAKAEAAILPLLDAPAGSVSIRHKLAEFAEAHGL
FT                   SL"
     atgcggagca cgtcgggcgg cccccgcgtc ttgctgagac ggctccgtga aaccatggcg        60
     gagcaagtct ccgcgcagga acggctggac aagatcgtgg tgctgatcgc cgccaacatg       120
     gtggcggagg tgtgctcgac ctatgtgctg cgggtcgaca acacgctcga actctacgcc       180
     accgaaggcc tcaaccgcga agccgtgcac cagaccgtgc tcaacgcgca tgaaggcctg       240
     gtcggcctgg tcgcctccga ggcgacgccg ctgaatctct ccgacgccca aagccacccg       300
     gcgttctcgt tccgcccgga aaccggcgaa gaaatctatc actccttcct cggcgtgccg       360
     atcctgcgcg ccggcaacac gctcggcgtg ctggtggtgc agaaccgcgc caagcgcact       420
     tatgtcgaag aagaagtcga ggcgctgcag accaccgcga tggtgctcgc cgagatgatc       480
     gcctcgggcg aattgtccgc cctggcgcag cccggcgccg aaccggcggc gcggcactcg       540
     atccacaaga ccggcgcgat cctgtcggac ggcatcgcgc tcggccatgt cgtgctgcac       600
     gagccccgcg tcgtcatcac caattacatc gccgaggatc tccccaagga gatcaagcgg       660
     ctcgatgccg ccttggccaa gctgcgcgcc gatctcgacc ggttgctgga gcgcggcgac       720
     gtcgccgacg gcggcgagca tcgcgaggtg ctggaagcct accggatgtt cgccaacgac       780
     catggctggt cgcaccggct gcacgaggcg gtggccaccg gcctgaccgc ggaggcggcc       840
     gtcgagcgtg tgcagtccga cacccgcgcc cggatgctgc gctcgaccga cccctatctg       900
     cgcgaccgcc tgcacgatct cgaagatctc ggccaccggc tgatgcgcca gctcgtcggg       960
     cagaatcatg cgccgtcccg cgagcaactg cccgacaacg ccatcctgat cgcgcgctcg      1020
     atgggacctg cggcgctgct ggactacgac cggacccggc tgcgaggcct ggtgctcgag      1080
     gaaggcaccg cgaattcgca cgtgtcgatc gtggcgcgcg cgctcggcat cgccgcggtc      1140
     ggcgaggtgc cgaacgcgcc aggcatcgcc gatcccggcg acgcgatcat cgtggatgcg      1200
     acctccggct cgatctatgt gcggccatcg gcggaagtcg aggccgccta tggcgagcgc      1260
     gtgcgcttcc gcgcccgccg ccaggcgcag tattcggcgt tgcgcgatct ggcctgcgtc      1320
     accaaggacg gccagccgat cgacctgatg atcaatgccg gcctcgcgat cgacctgccg      1380
     catatcgacg acaccggctc gtccggcatc ggcctgtttc gcaccgagct gcagttcatg      1440
     atcggccaga gcctgccgcg ctcgagcgac cagctcgcgc tgtatcgcac cgtgctcgac      1500
     gccgccggct cgaaaccggt gacgttccgc acgctcgaca tcggcggcga caaggcgctg      1560
     ccttatatgg agacggtggt cgaggagaat ccggcgctgg gctggcgcgc gatccggctc      1620
     gggctcgacc ggccgggcct gttgcgcagc cagattcgcg cgctgctgcg cgccggcggc      1680
     ggccgctcct tgcgcatcat gttcccgatg atttccgagg tcgcggagtt cgacgccgct      1740
     aaggcgatcg tcgagcgcga attgacctat ctgcgtcagc acggccacac cttgccggag      1800
     cgcgtcgacg tcggcaccat ggtcgaggtc ccggcgctgc tttatcagct cgacgagttg      1860
     ttgaagaagg tcgacttcat ctcggtcggc tccaacgatc tgttccagtt cctgtacgcg      1920
     gtcgatcgcg gcaattcgaa agtgtcggat cgcttcgaca cgctgtcgac gccgatcctg      1980
     cgtgcgctgc gccacatcgt gcgcaaggcg aaggccgcaa accgctcggt gtcgctgtgc      2040
     ggcgagatgg cgtcgcagcc gctgtcggcg ctggcgctga tcgcgatcgg ctaccgcgcg      2100
     ctgtcggtgt cggcggtgtc gcacggcccg atcaaggcga tgatcctgga ggtcgacgcc      2160
     gccaaggccg aggcggcgat cttgccgctg ctcgacgcgc ccgcgggcag cgtctcgatc      2220
     cggcacaagc tcgcggaatt cgccgaggct cacgggctct ctttgtag                   2268
//

If you have problems or comments...

PBIL Back to PBIL home page