(data stored in ACNUC9543 zone)

EMBL: CP000308.PE103

CP000308.PE103       Location/Qualifiers
FT   CDS_pept        123046..124374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0103"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12072"
FT                   /db_xref="GOA:A0A0E1NWS4"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWS4"
FT                   /protein_id="ABG12072.1"
FT                   /translation="MLPESVCYSVANANRQPPLQINSGRYLNIGGGLVVIGFIGFLLWA
FT                   GLAPLDKGVAVTGLLVVAENRKVIQPLQGGRIQQLHVTEGDEIVSGQLLVTLDDTAIRN
FT                   QRDNLQHQYLSALAQEARLTAEQNDLDVITFPQALLEHATQPAVERNIILQQQLLHHRR
FT                   QAHLSEIARLSTQLTRHQARLDGLQAMRSNHQRQSNLFQQQLDSVQLLAKDGHIAKNKL
FT                   LEMESQSTSLQARVEQSTSDIAEAHKLIDETEQHVLQRREQYQSENSEQLAKAQQNTQE
FT                   LVQRLNIAEYELSHTRIFAPVSGSVIALAQHTVGGVVSSGQALMEIVPSGQPLFVEAQL
FT                   PVELIDKVAVGLPVDLNFSAFNQSNTPRLQGSVWRIGADRIQPPPTSPPYYPLTVAIDL
FT                   DPTELAIRPGMAVDVFIRTGERSLLSYLFKPFTDRLHLALAEE"
     atgttgcctg aatcagtctg ttattcggtt gcgaatgcca atcgccaacc accactccaa        60
     ataaacagtg ggcgctatct caatataggt ggggggctgg tcgttatcgg cttcatcggc       120
     tttttacttt gggcggggtt agcgccgtta gataaaggcg ttgccgtgac cgggctgctt       180
     gtggtggcag aaaaccgcaa agtgatccag ccgctgcaag gggggcgtat tcagcaactg       240
     catgtcactg aaggcgacga aatagtgtct gggcaattat tggtcacgct ggatgacacg       300
     gcgatacgca atcagcggga taatttacag catcagtatc taagcgccct tgctcaggaa       360
     gcacgtttaa ctgctgagca aaacgatctg gatgtgatca ctttcccgca ggcgctgctt       420
     gagcacgcaa cacaaccagc ggttgaacgt aatattattt tgcagcaaca gcttttacat       480
     caccgccgcc aggcgcactt gagtgaaatc gcccggttat cgacacagct cactcgccat       540
     caggctcggc tcgatgggtt gcaagctatg cggagcaatc atcaacgtca atccaattta       600
     ttccagcaac aattagacag tgtgcagtta ttggcaaagg atggtcatat tgccaaaaat       660
     aaattgttag aaatggaaag ccagtcaacc tcactccagg cacgagtaga acaaagtacc       720
     agcgatattg cggaagcaca taagcttatc gatgaaacag aacaacatgt tttacaacgg       780
     cgcgaacaat atcaaagtga gaatagcgag caattagcca aggcacagca aaacacccaa       840
     gaactggtcc aacgtttaaa tattgcagaa tatgaattga gtcatacccg tatttttgca       900
     ccagtcagtg gttcagttat cgcattggct caacacactg tggggggcgt agtaagctca       960
     gggcaggcat taatggaaat tgtccccagt gggcagccgt tattcgttga ggctcagttg      1020
     ccggtggagc taattgataa ggttgcggtc gggctacctg tagatctcaa tttttctgcg      1080
     tttaatcaaa gtaatacccc ccggctacaa ggctctgtat ggcgcatcgg agccgatcgt      1140
     atacaacccc cacctacttc accgccttat taccctttaa ccgttgcgat tgatcttgac      1200
     ccgacggaac tggcaatccg tccaggtatg gccgttgatg tttttatacg taccggagaa      1260
     aggtcattac tcagctattt atttaagcca ttcactgatc gcctgcacct cgcgttagcc      1320
     gaggaataa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page