(data stored in ACNUC9543 zone)

EMBL: CP000308.PE107

CP000308.PE107       Location/Qualifiers
FT   CDS_pept        127794..128711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0107"
FT                   /product="oxidative stress transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12076"
FT                   /db_xref="GOA:A0A0E1P2E1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2E1"
FT                   /protein_id="ABG12076.1"
FT                   /translation="MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELGI
FT                   MLLERTSRKVLFTQAGLLLVEQAKTVLREVKVLKEMASLQGESMSGPLHIGLIPTVGPY
FT                   LLPQIIPMLHKTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEIPLFDE
FT                   PMNLAIYADHPWANRERVEMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPALAVPNERQRDGVCYLECYKPVPKRTIALVYRPGSPLRGR
FT                   YEQLAEAIRDHMQERMAPSLEQAI"
     atgaatattc gtgatctaga gtacttagtg gcgttggctg aatttaggca cttccggcgt        60
     gccgccgact cctgtcatgt cagccaaccc acattaagcg gtcagattcg taaactggaa       120
     gatgagttgg ggatcatgtt gttggagcga actagtcgta aggtgttgtt tacacaggct       180
     ggtttactgt tggtggagca ggcgaaaacg gtattacggg aagtgaaagt actgaaagag       240
     atggccagtt tacagggtga aagtatgtct gggccgttgc atattgggct tattcctacc       300
     gttgggcctt atctgttacc acaaattatt cctatgctgc ataaaacatt ccccaaattg       360
     gaaatgtatc tgcatgaagc ccagacccaa aatctcttag cccagttgga tagtggtaaa       420
     ttggattgtg ccattttagc cctggtcaaa gagaccgaag cttttatcga aattccgtta       480
     tttgacgagc cgatgaatct agccatttat gccgatcatc cgtgggcgaa ccgcgaaaga       540
     gtggagatgc atgaattggc gggagagaag ttactgatgc tggaagatgg tcattgttta       600
     cgtgatcagg cgatgggctt ttgcttccag gctggagcgg atgaagatac tcacttccgg       660
     gcgactagct tggaaaccct gcgcaacatg gtcgcagcgg gtagtggtat tacgctgttg       720
     ccagcactgg ctgtgccgaa tgaaagacag cgcgatggtg tatgttatct ggagtgctac       780
     aaacctgtcc ctaaacgcac cattgcgttg gtgtatcgcc ccggttctcc attgcgtggc       840
     cgctatgaac aacttgccga ggcaatacgt gatcacatgc aagagcgcat ggccccatca       900
     ttagaacagg cgatttaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page