(data stored in ACNUC9543 zone)

EMBL: CP000308.PE109

CP000308.PE109       Location/Qualifiers
FT   CDS_pept        130312..130947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0109"
FT                   /product="TetR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12078"
FT                   /db_xref="GOA:Q1CBU4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBU4"
FT                   /protein_id="ABG12078.1"
FT                   /translation="MGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVSREAGIAP
FT                   TSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPN
FT                   AFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRSFTEAQAEAMVTIVFS
FT                   AGAEVLDVDIEQRRQLEERLVLQLRMISKGAYYWYRREQEKLAASRVE"
     atgggcgtca gagcacaaca aaaagagcgg actcgtcgtt cccttatcga agcggcgttc        60
     agtcaactga gtgctgagcg gagctttgcc agcctgagct tacgggaagt ctcccgtgaa       120
     gcaggtatcg caccgacttc tttttaccgg catttccggg atgtcgacga gcttgggcta       180
     accatggttg acgaaagcgg cctgatgtta cgtcaattaa tgcgtcaggc acggcaacgg       240
     attgccaaag gcggcagcgt tatccgtaca tcggtgtcca cctttatgga gtttatcggc       300
     aacaacccta atgcgtttcg tttgctgctc agggaacgtt ccgggacttc cgccgctttt       360
     cgtgctgcgg ttgcgcgtga aattcagcac tttattgctg aactggcaga ttacctcgag       420
     ttagaaaatc acatgccacg tagcttcact gaggctcaag ctgaggccat ggtcacaatt       480
     gtcttcagtg caggtgcaga agtactggac gtggatattg aacagcggcg acagttagaa       540
     gaacgcttgg tcttacagtt acggatgatc tccaaaggtg cttactattg gtatcgccgt       600
     gaacaagaaa agcttgctgc gtcccgtgta gaataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page