(data stored in ACNUC9543 zone)

EMBL: CP000308.PE110

CP000308.PE110       Location/Qualifiers
FT   CDS_pept        130960..131367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0110"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12079"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPR0"
FT                   /protein_id="ABG12079.1"
FT                   /translation="MEQSSRRETGTLLLALITGLAINGVCAALFSALVPFSVFPLLTLI
FT                   LAVYCLHQRYLNFAMPQGIPVLASACFLLGILLYSAIVRVEYPAIGSNFVPAVLSVVLV
FT                   FWILFKLRTRKSVQTHTDADIDINNSDQPQQ"
     atggaacaat cttctcgccg tgaaaccggc accctactac tggcattaat tactggcttg        60
     gcgataaatg gggtatgtgc cgcgttattc agtgcgctgg tgcctttttc agtttttcca       120
     ctactgacgc tcatactggc ggtgtattgc ctacatcagc gttatctcaa ttttgctatg       180
     ccgcaaggga taccggtgct ggcttcagca tgtttcctgc ttgggatctt gttgtacagc       240
     gcgattgtgc gggtggaata ccctgcaatt gggtctaact tcgttcctgc ggtgctcagt       300
     gtggtgttgg tgttctggat cttatttaaa ttaagaacac gtaaatcggt acaaacacat       360
     acagatgcgg atattgatat caataactcg gatcaaccac agcaatag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page