(data stored in ACNUC9543 zone)

EMBL: CP000308.PE118

CP000308.PE118       Location/Qualifiers
FT   CDS_pept        complement(147171..148052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0118"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12087"
FT                   /db_xref="GOA:Q1CBT5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CBT5"
FT                   /protein_id="ABG12087.1"
FT                   /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGA
FT                   NLFTRHRNNIRLTPAGERLVPYAEMLLNTWRLAKKEVIHSLQHTELSIGATASLWEAYL
FT                   TPWLQQLYEQQEELRLEARIALRNSLVKQLHERQLDLLITTEPPKMDELACLLLGHFSL
FT                   RLYSSFSLDLPKEDDTPNEHKNASEVPYIKLEWGADFHQQENRLLDSEQAPILTTTSAH
FT                   LTRQLLETTGGCAFLPEHWQKEYPQLVIHPDIPPIVRPLYAVWLQNSDQQALIRQLLKT
FT                   PMNNATQSVTRE"
     gtggataccg aattactgaa aaccttttta gaggtcagta gaactcgtca ctttggtcgc        60
     gcagctgaat ctctgtactt aacacagtcg gcggtaagtt tccgtatccg tcagttggaa       120
     aatcaattag gtgcaaactt attcactcgg catcgtaata atattcgtct cactcctgcg       180
     ggtgaacggc tggttccgta cgcagaaatg ctgctgaaca cttggcgatt agccaaaaaa       240
     gaagtcatac attcgctaca acacactgag ttatccatag gtgcaaccgc atccctttgg       300
     gaggcgtacc tcactccatg gttgcaacag ttatatgaac aacaagagga actacgcctt       360
     gaagcacgca ttgcgctgag aaactcactg gtgaagcagt tgcacgaacg gcaactggac       420
     ttgttgatca cgacagaacc gcccaaaatg gatgaactgg cctgcctgct attaggccat       480
     ttttcactgc ggctttattc gtcgttctcc cttgatttac caaaagaaga tgacaccccg       540
     aacgagcata aaaatgcaag tgaagtgcct tatatcaaac ttgaatgggg ggctgatttc       600
     catcagcagg aaaaccgttt acttgatagt gagcaggcgc caatcctcac aacgacctct       660
     gcccatttaa cccgccagtt gcttgaaacg actggcggtt gcgcttttct gcctgaacat       720
     tggcaaaaag aatacccaca gcttgtcatt catcctgaca ttccaccgat cgtgcggcca       780
     ctgtatgccg tttggctaca aaacagtgac cagcaagcat tgatcagaca actcttaaaa       840
     acccccatga ataacgcgac ccagagcgtt acacgggagt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page