(data stored in ACNUC9543 zone)

EMBL: CP000308.PE12

CP000308.PE12        Location/Qualifiers
FT   CDS_pept        11303..11473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABG11981"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4C8"
FT                   /protein_id="ABG11981.1"
FT                   /translation="MARAGLPIIAGYEVVSDFEFGGGLVALKQRLNNPEAEPQVLPLTP
FT                   ELIERGSVSLR"
     atggcacgtg caggtttgcc aattattgcc gggtatgaag ttgtcagtga ttttgaattt        60
     ggtggtggcc tggttgccct gaagcaacga ctaaataatc cagaagctga gccacaagtt       120
     ctgcccctga ctcccgagct aatagaacgc ggttcggtct cccttcgtta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page