(data stored in ACNUC9543 zone)

EMBL: CP000308.PE126

CP000308.PE126       Location/Qualifiers
FT   CDS_pept        complement(157603..158067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0126"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12095"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQN9"
FT                   /protein_id="ABG12095.1"
FT                   /translation="MKAKSKKIICALLLLGSILLGYFFWLSLRPVEIVAIHKDGNFSAV
FT                   LVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDRLC
FT                   FSDMNTTKNCIEKEKYMTIYKIKNDEPLFSFDGNRYFLNENNKIVKMKRE"
     atgaaagcaa aaagtaaaaa aatcatctgc gcgctattac tgcttggcag cattttactg        60
     ggttatttct tctggttatc gttgcgcccg gtggaaattg tcgctattca taaggacggg       120
     aattttagtg ctgttttagt gagagatttt ccggttactg acaaaggtaa aataaattgg       180
     tggttagaaa ataaaagtag attaaaagac aaatacaata ttcctaaccc tgcccctgat       240
     ggcttttttt ctatcactat ttgggatttt ggtgacggct ataaagagga aggaaagtac       300
     gacagactgt gttttagcga tatgaatacg accaaaaatt gtatcgagaa agaaaaatat       360
     atgactattt acaagataaa aaatgatgaa ccattgttct cctttgatgg aaatagatat       420
     tttttaaacg aaaacaataa aattgttaaa atgaaacgcg aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page