(data stored in ACNUC9543 zone)

EMBL: CP000308.PE127

CP000308.PE127       Location/Qualifiers
FT   CDS_pept        complement(158147..158608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0127"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12096"
FT                   /db_xref="InterPro:IPR010351"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRW1"
FT                   /protein_id="ABG12096.1"
FT                   /translation="MKAKSKKTLYALLLIGSVLLGYFFWLSLRPVEIVAVHKDRNFSAV
FT                   LVRDFPVTDKGKINWWLENKSRLKDKYNIPNPAPDGFFSITIWDFGDGYKEEGKYDRRC
FT                   FEDMKTSKNCIDKNSLMIIRNSQYNVMSFTLDSGIYQLKNGEIVKMKHE"
     atgaaagcaa aaagtaaaaa gactctctat gcactattac tgattggcag cgttctactg        60
     ggttatttct tctggttatc gctgcgcccg gtggaaattg tcgctgttca taaggacagg       120
     aattttagtg ctgttttagt gagagatttt ccggttactg acaaaggtaa aataaattgg       180
     tggttagaaa ataaaagtag attaaaagac aaatacaata ttcctaaccc tgcccctgat       240
     ggcttttttt ctatcactat ttgggatttt ggtgacggct ataaagagga aggaaaatac       300
     gatagacgat gttttgagga tatgaaaacc agtaagaatt gtatagataa aaattcactt       360
     atgattataa gaaatagcca atataacgta atgtctttta ctttggacag tggcatatat       420
     cagttaaaaa atggcgaaat cgttaaaatg aaacacgaat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page