(data stored in ACNUC9543 zone)

EMBL: CP000308.PE130

CP000308.PE130       Location/Qualifiers
FT   CDS_pept        160159..160368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZ34"
FT                   /protein_id="ABG12099.1"
FT                   /translation="MEDNGAVAKETIEGTVGYIGDDISLLTSAMNNFSSQVSEQVSMLG
FT                   AIQSNVTGSIAMISCYSIGRVIAA"
     atggaagata atggtgctgt agctaaagaa acgatagaag gtactgttgg gtatataggg        60
     gatgatatca gtttattgac atcggcaatg aataacttct caagccaagt ttctgaacaa       120
     gttagcatgc tcggtgctat tcaaagtaat gttacaggta gcattgcaat gattagctgt       180
     tattcaatag gccgtgttat tgccgcttaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page