(data stored in ACNUC9543 zone)

EMBL: CP000308.PE133

CP000308.PE133       Location/Qualifiers
FT   CDS_pept        163645..165087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0133"
FT                   /product="colicin"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12102"
FT                   /db_xref="GOA:A0A0E1NS99"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NS99"
FT                   /protein_id="ABG12102.1"
FT                   /translation="MGLLMQQQRVNADLETAKITEPQRVENARLTAEAAEKAARDRRIS
FT                   EEIAATEAKRQRMENERLAEQERQRVEGTKQQVSEASCAQQASAWQNRFTLPALQPSGS
FT                   AQYSFAASGMSAVGEAAELHNSFLAAQEQLSAIATISASGSVAAMIALGIYQTKVGESS
FT                   ERPPGWNVSPKFVGSISLSAMGLPATESLASQGEMALPVRMRIIDAKDWIGCTEIYAVK
FT                   TGVAGVLPKVKVGAAQYDESTGVYTFTTDSTPPRTLIFTPAQPPGAETRPILAPPGSTP
FT                   ATLQHTGEMIIKPVITPTILPLPQLYARDFHDYIIWFPADSGLEPVYVYLNSPYGKTTA
FT                   KGKYSGRDFNPDKAGGPIKNLDWKEIKIRGEGVDEVKLHTRRFGELEDNKLMIERLEKI
FT                   LTNKLTATDIDKHFYTHEIRELERYRMLGIPDDVNDKSVWNDAHTATLEDFKINEKTQP
FT                   LYTSEAEDAYIKAELKNSLGSK"
     atgggcctct taatgcagca acagcgtgtt aatgccgatc tggagacagc aaaaatcaca        60
     gagccgcagc gagttgagaa tgcacgttta accgcagaag cagcagaaaa ggccgcgcgc       120
     gatcgcagga tcagtgaaga gatagcggca acagaagcaa agcgccagcg aatggagaat       180
     gagcggctag cagagcagga gcggcagcga gttgaaggca ccaaacagca agtatcggaa       240
     gcatcatgtg ctcaacaggc ctcagcctgg caaaatcgtt tcacgttacc ggcgcttcag       300
     ccgtcaggat cagctcaata cagctttgca gcgtcgggaa tgagtgctgt tggggaagcc       360
     gccgaattac acaattcatt tctggcggca caggagcaac tcagtgcgat agcgaccatt       420
     tcggcatcag gttcggtggc ggcgatgatt gctctgggga tctaccagac taaagtggga       480
     gaaagctccg aacggccacc gggttggaat gttagtccga aatttgtagg cagtatctcg       540
     ctgagtgcaa tggggttacc tgcgacagaa tcattggcat cacagggtga aatggctctg       600
     ccagtgcgaa tgcggatcat tgacgctaaa gattggatag gttgcacgga gatatatgcg       660
     gtaaaaacgg gcgtggcagg tgtattgccg aaggtcaaag ttggtgcagc gcagtacgat       720
     gaatcaaccg gcgtttatac tttcactacc gacagcacgc cgccccgcac gctgattttt       780
     accccggcac agccaccggg agcggaaacc cgcccgatat tagccccacc gggcagcacg       840
     ccggccaccc tgcagcacac gggtgaaatg atcataaaac cggtaataac accgactata       900
     cttccactac cgcagttata tgcgcgtgat ttccacgatt acattatctg gttcccggca       960
     gattccgggc tggagccagt gtatgtttac cttaatagtc cttatggtaa aacaactgct      1020
     aaaggtaaat atagtggtcg tgactttaat ccagataaag ctggtggtcc gattaaaaat      1080
     ctggactgga aagaaataaa aattagggga gagggtgtgg atgaggtaaa actacataca      1140
     aggcgttttg gtgaattaga ggataataaa ttaatgatcg agaggttgga gaaaattctc      1200
     acaaacaaac tcaccgctac cgatattgat aagcacttct atactcatga aatcagagag      1260
     ctagaacgat atcgtatgct aggaataccg gatgatgtca atgataaatc tgtttggaat      1320
     gatgctcata cagcaactct ggaagatttt aaaattaatg aaaaaactca gccattatat      1380
     acttcagaag ctgaagatgc atatatcaaa gcagagttaa aaaattcgtt agggagtaaa      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page