(data stored in ACNUC9543 zone)

EMBL: CP000308.PE136

CP000308.PE136       Location/Qualifiers
FT   CDS_pept        165856..166113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0136"
FT                   /product="colicin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12105"
FT                   /db_xref="GOA:A0A0E1NNA5"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNA5"
FT                   /protein_id="ABG12105.1"
FT                   /translation="MELKEKYEDYTEHEFLEFIRNICEVNTDSQSLHSSWVRHFTKITE
FT                   HPSGSDLIYYPEDGADDSPEGILELVKKWRAENGKPGFKK"
     atggaactta aagagaagta tgaggattat acagagcatg aatttttaga gtttattaga        60
     aatatttgtg aggtgaatac tgatagtcaa tctttgcata gttcatgggt gagacacttc       120
     acaaaaatca ctgagcatcc gtcaggatca gatttaattt attatccaga agatggtgca       180
     gatgatagtc cagaaggaat acttgagtta gtaaaaaaat ggcgagctga aaatggtaag       240
     cccggtttca aaaaataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page