(data stored in ACNUC9543 zone)

EMBL: CP000308.PE137

CP000308.PE137       Location/Qualifiers
FT   CDS_pept        complement(166566..166724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4L0"
FT                   /protein_id="ABG12106.1"
FT                   /translation="MGASSAQTLEAYYGLNITHNFSPCYIPVPLQDAGTLAALAHPSHL
FT                   VVDLKNK"
     ttgggggcga gtagtgcaca gacactggaa gcttattacg gtttgaatat aactcataat        60
     ttctctcctt gttatatacc cgtccccctg caagatgcag ggacgttagc cgcccttgct       120
     caccccagtc acttagttgt tgaccttaaa aataaataa                              159
//

If you have problems or comments...

PBIL Back to PBIL home page