(data stored in ACNUC9543 zone)

EMBL: CP000308.PE142

CP000308.PE142       Location/Qualifiers
FT   CDS_pept        complement(172366..172896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0142"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12111"
FT                   /db_xref="GOA:A0A0E1NQQ9"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQQ9"
FT                   /protein_id="ABG12111.1"
FT                   /translation="MKKITLAIALFSASTTVAMSASNNTITFQGEVTAQTCSVTVNGLE
FT                   ANPVVLLPTVSSSDLDASGQTKGKTTFTLGVSGCTSGSDDLDIKTVFIGSLVTATGNLQ
FT                   NTGTAGNVELQLLKDATTTTGIDLNSGLAQDGIVLLAGDTSAEHDFAVQYYATGQSTPG
FT                   SVIASVQYAVSYL"
     atgaaaaaaa ttactttagc tatcgcgtta ttctcggcat ctacaacggt tgccatgtct        60
     gccagtaata atacgattac gttccaaggg gaagtcacag cacaaacctg ttctgttacc       120
     gtaaacggcc ttgaagcaaa tccagttgtc ttgttgccta cagtatcaag tagcgattta       180
     gacgcttccg gccaaactaa aggcaaaaca acctttacgc taggtgtgtc tggctgtaca       240
     tcaggatcag atgatcttga tatcaaaact gttttcatcg gtagcctggt tactgctact       300
     ggtaatttac aaaatacagg taccgcaggg aacgttgaac ttcaattatt gaaggatgcc       360
     acgacaacaa cgggtatcga cctgaatagt ggtttggcac aagacggtat cgtgttgcta       420
     gcaggtgata catctgcgga gcatgatttt gctgttcagt attatgccac tgggcaatca       480
     acaccagggt ctgtcattgc atctgtacag tatgccgttt cttacttgta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page