(data stored in ACNUC9543 zone)

EMBL: CP000308.PE148

CP000308.PE148       Location/Qualifiers
FT   CDS_pept        complement(179704..180210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12117"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y2C5"
FT                   /protein_id="ABG12117.1"
FT                   /translation="MMLSSTSLYAAIDLGSNSFHMLVVREVAGSIQTLARIKRKVRLAA
FT                   GLDNQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRVVATATLRLASNADEFLRTATEI
FT                   LGCPIQVISGEEEARLIYHGVAHTTGGPEQRLVVDIGGAALSWLQAMGLRRIFWSAYQW
FT                   VVLPG"
     atgatgctaa gttccacctc actttatgct gccatcgatc ttggctccaa tagttttcat        60
     atgttggtag tacgtgaggt ggctggcagt atccaaacgc tggcacgtat taagcggaag       120
     gtccgcctgg cggctggtct ggataaccaa aatcatctat cgcaggaagc gatggaacga       180
     ggctggcaat gcctaaaact tttctcagag cgtttacagg atattcctct ggatcaaatc       240
     cgcgtggtcg caacggcaac cttgcgcctg gcctctaatg ccgacgaatt cttgcgtact       300
     gcaaccgaga tcctcggctg ccctattcaa gtcatcagtg gcgaagaaga agcccgtctg       360
     atttatcatg gcgtagcgca tacgactggc gggccagaac agcggttggt cgtcgatatt       420
     gggggggcag cactgagttg gttacaggca atggggctca ggcgaatatt ttggtcagcc       480
     tatcaatggg ttgtgttacc tggttag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page